Property Summary

NCBI Gene PubMed Count 67
PubMed Score 334.09
PubTator Score 169.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Gene RIF (54)

PMID Text
26832773 HABP2 G534E appears to be a susceptibility gene in a subgroup of Familial Non-Medullary Thyroid Cancer (FNMTC), providing important diagnostic implications for this hereditary thyroid cancer.
26745718 No evidence supporting a role for the HABP2 G534E variant (SNP rs7080536) in papillary thyroid carcinoma.
26732560 HABP2, which encodes an extracellular serine protease involved in coagulation, fibrinolysis, and inflammatory pathways, may be a genetic susceptibility locus for early-onset stroke. [Meta-Analysis]
26222560 results suggest that the HABP2 G534E variant is a susceptibility gene for familial nonmedullary thyroid cancer
25847894 CD44 expression in squamous cell carcinoma of the penis cannot predict the need of performing inguinal lymphadenectomy.
25370187 Patients with Gram-negative sepsis caused by B. pseudomallei have abundant FSAP activation, which significantly correlates with stage of disease.
24497464 FSAP functions in initiation and progression of hepatic fibrosis
24075769 FSAP activates the NF-kappaB pathway and the associated downstream pro-inflammatory factors in monocytic cells
23575879 The possible effects of omega-3 FA on clinical AF potential could be linked with modulation of circulating FSAP levels.
23341458 Data indicate that FSAP mediates proteolytic cleavage and activation of bone morphogenetic protein-2 (BMP-2).
22989567 Lower FSAP expression is associated with enhanced liver fibrosis and inflammation in patients with chronic hepatic disorders and murine experimental liver injury.
22906531 The study demonstrated that a single nucleotide polymorphism (Marburg I) in the FSAP gene (HABP-2)results in a weak proteolytic activity against all substrates including FVII.
22850287 High levels of FSAP activity were predictive of adverse events during follow-up, suggesting its potential role in risk stratification and clinical management of CAD patients.
22449009 Report tissue factor pathway inhibitor as an efficient inhibitor of factor VII-activating protease.
22421107 We conclude that FSAP Marburg-I genotyping may be used to determine the risk for thromboembolic disorders in patients with suspected thrombophilia and known DVT or PE.
22409238 Increased plasma FSAP antigen levels and activity were associated with ischemic stroke and all main etiologic subtypes.
22383781 Data suggest that plasma FSAP activity levels were higher in women with recurrent pregnancy loss than in fertile women.
22308306 A high correlation between FSAP activity and C5a was found in multiple trauma patients
22235940 FSAP activates single-chain urokinase-type plasminogen activator, but FVII appears remarkably resistant to activation.
22116096 Factor VII-activating protease promotes the proteolysis and inhibition of tissue factor pathway inhibitor.
21737124 The increase in FSAP is comparable in the seven OC-groups studied but is more significant in women carrying the 1601GG genotype than in women with the 1601GA genotype and results in increased activation of FVII
21655671 SNP analyses indicate an important role for FSAP in the regulation of the haemostasis system as well as fibroproliferative inflammatory processes. [review]
21600885 these results suggest pathophysiological relevance of histone-dependent pro-PHBP activation in hyperinflammatory process.
21098215 These results indicate that polymorphisms in the regulatory region of HABP2 gene could influence gene expression levels in the receptive endometrium and be one reason for infertility complications in women with unexplained infertility.
21071862 identified laccaic acid as a potent inhibitor of the protease in terms of both autoactivation of the PHBP proenzyme (IC(50) = 0.35-0.55 microg/ml) and the catalytic activity of the active enzyme (IC(50) = 1.1 microg/ml).
20818495 FSAP inhibited platelet-derived growth factor-stimulated proliferation, migration, p42/p44 MAPK phosphorylation and collagen III synthesis of the human pulmonary fibroblasts.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20558613 The protein products HABP2 and HYAL1 were associated with plasma PAI-1 concentration and play key roles in hyaluronan metabolism, providing genetic evidence to link these pathways.
20558613 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20532885 Observational study of gene-disease association. (HuGE Navigator)
20045910 Marburg I polymorphism of FSAP might not be associated with cerebral infarction.
20042707 Hyaluronic acid binding protein 2 (HABP2) negatively regulates vascular integrity via activation of protease-activated receptor/RhoA/Rho kinase signaling. It represents a potential therapeutic target for syndromes of increased vascular permeability.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19817990 Report that polyamine induces the formation of pro-PHBP autoactivation complex, in which an intermolecular interaction between N-terminal region and the third EGF-like domain (E3) plays a role.
19446554 The naturally occurring G534E-variant exhibited reduced proteolytic activity. The DeltaEGF-3 mutant showed diminished binding to and activation by heparin.
19105210 The G534E variant of FSAP is a risk locus for HCV-induced liver fibrosis and cirrhosis by determining PDGF-BB-mediated hepatic stellate cell proliferation through a single amino acid substitution in FSAP.
19105210 Observational study of gene-disease association. (HuGE Navigator)
18394684 Observational study of gene-disease association. (HuGE Navigator)
18278202 Failed to validate association of FSAP gene polymorphisms with venous thromboembolism amoung Californians of European ancestry.
17540775 FSAP is a novel plasma-derived serine protease structurally homologous to tissue-type and urokinase-type plasminogen activators present in bronchoalveolar lavage fluids from patients with acute respiratory distress syndrome.
17482622 factor VII activating protein (FSAP) was focally accumulated in hypocellular and lipid-rich areas within the necrotic core of atherosclerotic plaques in cornorary arteries
17479202 The Marburg I polymorphism of factor VII-activating protease and the risk of venous thromboembolism.
17145954 FSAP has a protective function in the vasculature, and analysis of G534E polymorphism (Marburg I) polymorphism is likely to be clinically relevant in restenosis.
17003923 Observational study of genotype prevalence. (HuGE Navigator)
16461761 No association between polymorphism and risk of venous thromboembolism.
16385451 Observational study of gene-disease association. (HuGE Navigator)
16332249 The identification of polyanion-binding sites will help to define the role of FSAP in the vasculature.
16153533 exhibits a significant growth factor-like activity on quiescent human lung and dermal fibroblasts
15933067 Marburg I polymorphism of factor VII-activating protease does not have a role in venous thrombosis [letter]
15654766 extracellular RNA, present at sites of cell damage or vascular injury, can serve an important as yet unrecognized cofactor function in haemostasis by inducing (auto-)activation of FSAP through a novel surface-dependent mechanism
15543324 Observational study of gene-disease association. (HuGE Navigator)
15543324 An interactive effect upon risk was found between the 511E allele and elevated levels of cholesterol and triglyceride or fibrinogen. The findings support the proposal that the FSAP 511E allele exacerbates atherosclerosis or its clinical sequelae
15486068 Observational study of gene-disease association. (HuGE Navigator)
15486068 The frequency of factor VII-activating protease Marburg I is significantly increased in patients with a history of venous thromboembolism (VTE) or idiopathic VTE compared to healthy controls.

AA Sequence

MFARMSDLHVLLLMALVGKTACGFSLMSLLESLDPDWTPDQYDYSYEDYNQEENTSSTLTHAENPDWYYT      1 - 70
EDQADPCQPNPCEHGGDCLVHGSTFTCSCLAPFSGNKCQKVQNTCKDNPCGRGQCLITQSPPYYRCVCKH     71 - 140
PYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKFTCACPDQFKGKFCEIGSDDCYVGDGYSYRGKMNRTV    141 - 210
NQHACLYWNSHLLLQENYNMFMEDAETHGIGEHNFCRNPDADEKPWCFIKVTNDKVKWEYCDVSACSAQD    211 - 280
VAYPEESPTEPSTKLPGFDSCGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTISMPQGHFCGGA    281 - 350
LIHPCWVLTAAHCTDIKTRHLKVVLGDQDLKKEEFHEQSFRVEKIFKYSHYNERDEIPHNDIALLKLKPV    351 - 420
DGHCALESKYVKTVCLPDGSFPSGSECHISGWGVTETGKGSRQLLDAKVKLIANTLCNSRQLYDHMIDDS    421 - 490
MICAGNLQKPGQDTCQGDSGGPLTCEKDGTYYVYGIVSWGLECGKRPGVYTQVTKFLNWIKATIKSESGF    491 - 560
//

Text Mined References (69)

PMID Year Title
26832773 2016 HABP2 G534E Mutation in Familial Nonmedullary Thyroid Cancer.
26745718 2016 HABP2 G534E Variant in Papillary Thyroid Carcinoma.
26732560 2016 Genome-Wide Association Analysis of Young-Onset Stroke Identifies a Locus on Chromosome 10q25 Near HABP2.
26691890 2015 The HABP2 G534E variant is an unlikely cause of familial non-medullary thyroid cancer.
26258071 2015 HABP2 is a Novel Regulator of Hyaluronan-Mediated Human Lung Cancer Progression.
26222560 2015 Germline HABP2 Mutation Causing Familial Nonmedullary Thyroid Cancer.
25847894 2015 Is it possible to predict the need of inguinal lymphadenectomy in patients with squamous cell carcinoma of the penis? A clinical and a pathological study.
25370187 2015 Diabetes-independent increase of factor VII-activating protease activation in patients with Gram-negative sepsis (melioidosis).
24497464 2014 Factor VII activating protease (FSAP): a novel protective factor in liver fibrosis.
24075769 2013 Regulation of monocyte/macrophage function by factor VII activating protease (FSAP).
23575879 2014 Association of circulating factor seven activating protease (FSAP) and of oral Omega-3 fatty acids supplements with clinical outcome in patients with atrial fibrillation: the OMEGA-AF study.
23341458 2013 The factor VII-activating protease (FSAP) enhances the activity of bone morphogenetic protein-2 (BMP-2).
22989567 2013 Factor VII activating protease (FSAP) exerts anti-inflammatory and anti-fibrotic effects in liver fibrosis in mice and men.
22906531 2012 The Marburg I polymorphism of factor VII activating protease is associated with low proteolytic and low pro-coagulant activity.
22850287 2012 Circulating factor VII activating protease (FSAP) is associated with clinical outcome in acute coronary syndrome.
22449009 2012 Tissue factor pathway inhibitor is an inhibitor of factor VII-activating protease.
22421107 2012 The G534E-polymorphism of the gene encoding the factor VII-activating protease is a risk factor for venous thrombosis and recurrent events.
22409238 2012 Plasma factor VII-activating protease antigen levels and activity are increased in ischemic stroke.
22383781 2012 Factor seven activating protease activity levels in women with recurrent pregnancy loss.
22308306 2012 Factor VII-activating protease is activated in multiple trauma patients and generates anaphylatoxin C5a.
22235940 2012 Factor seven activating protease (FSAP): does it activate factor VII?
22116096 2012 Factor VII-activating protease promotes the proteolysis and inhibition of tissue factor pathway inhibitor.
21737124 2011 Plasma factor VII-activating protease is increased by oral contraceptives and induces factor VII activation in-vivo.
21655671 2011 Factor VII activating protease. Single nucleotide polymorphisms light the way.
21600885 2011 Extracellular histone induces plasma hyaluronan-binding protein (factor VII activating protease) activation in vivo.
21098215 2011 Variation in hyaluronan-binding protein 2 (HABP2) promoter region is associated with unexplained female infertility.
21071862 2010 Inhibition of plasma hyaluronan-binding protein autoactivation by laccaic acid.
20818495 2010 Changes in factor VII-activating protease in a bleomycin-induced lung injury rat model and its influence on human pulmonary fibroblasts in vitro.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20558613 2010 Genetic variation in hyaluronan metabolism loci is associated with plasma plasminogen activator inhibitor-1 concentration.
20532885 2010 Study of 18 functional hemostatic polymorphisms in mucocutaneous bleeding disorders.
20045910 2009 [Marburg I polymorphism of Factor VII-activating protease and cerebral infarction].
20042707 2010 Hyaluronic Acid binding protein 2 is a novel regulator of vascular integrity.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19817990 2010 Polyamine-promoted autoactivation of plasma hyaluronan-binding protein.
19446554 2009 Structure-function analysis of factor VII activating protease (FSAP): sequence determinants for heparin binding and cellular functions.
19105210 2009 The Marburg I variant (G534E) of the factor VII-activating protease determines liver fibrosis in hepatitis C infection by reduced proteolysis of platelet-derived growth factor BB.
18394684 2008 Factor VII-activating protease in patients with acute deep venous thrombosis.
18278202 2008 Failure to validate association of gene polymorphisms in EPCR, PAR-1, FSAP and protein S Tokushima with venous thromboembolism among Californians of European ancestry.
17540775 2007 Plasminogen activator inhibitor-1 is an inhibitor of factor VII-activating protease in patients with acute respiratory distress syndrome.
17482622 2008 Factor Seven Activating Protease (FSAP) expression in human monocytes and accumulation in unstable coronary atherosclerotic plaques.
17479202 2007 The Marburg I polymorphism of factor VII-activating protease and the risk of venous thromboembolism.
17145954 2006 The G534E polymorphism of the gene encoding the factor VII-activating protease is associated with cardiovascular risk due to increased neointima formation.
17003923 2006 Gene polymorphisms implicated in influencing susceptibility to venous and arterial thromboembolism: frequency distribution in a healthy German population.
16461761 2006 Marburg I polymorphism of factor VII-activating protease and risk of venous thromboembolism.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16332249 2006 A positively charged cluster in the epidermal growth factor-like domain of Factor VII-activating protease (FSAP) is essential for polyanion binding.
16153533 2005 The hyaluronan-binding protease upregulates ERK1/2 and PI3K/Akt signalling pathways in fibroblasts and stimulates cell proliferation and migration.
15933067 2005 The Marburg I polymorphism of factor VII-activating protease is not associated with venous thrombosis.
15654766 2005 Extracellular RNA is a natural cofactor for the (auto-)activation of Factor VII-activating protease (FSAP).
15543324 2004 The factor VII activating protease G511E (Marburg) variant and cardiovascular risk.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15486068 2005 Marburg I polymorphism of factor VII-activating protease is associated with idiopathic venous thromboembolism.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12578864 2003 Marburg I polymorphism of factor VII--activating protease: a prominent risk predictor of carotid stenosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12452440 2002 The hyaluronan-binding serine protease from human plasma cleaves HMW and LMW kininogen and releases bradykinin.
12437095 Factor VII activating protease (FSAP): a novel protease in hemostasis.
12386823 2002 Novel candidate tumor marker genes for lung adenocarcinoma.
12138371 2002 The frequent Marburg I polymorphism impairs the pro-urokinase activating potency of the factor VII activating protease (FSAP).
11379758 2001 Proteolytic activation and inactivation of the serine protease activity of plasma hyaluronan binding protein.
11217080 2001 Identification of the substrates for plasma hyaluronan binding protein.
10754382 1999 The FVII activating protease cleaves single-chain plasminogen activators.
9443814 1997 Isolation and characterization of the plasma hyaluronan-binding protein (PHBP) gene (HABP2).
8827452 1996 Purification and characterization of a novel hyaluronan-binding protein (PHBP) from human plasma: it has three EGF, a kringle and a serine protease domain, similar to hepatocyte growth factor activator.
1724753 1991 Purification, partial characterization of rat kidney hyaluronic acid binding protein and its localization on the cell surface.