Property Summary

NCBI Gene PubMed Count 19
PubMed Score 45.83
PubTator Score 90.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Hypospadias 65
Disease Target Count Z-score Confidence
Pellagra 25 3.254 1.6

Expression

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (4)

PMID Text
20468071 Observational study of gene-disease association. (HuGE Navigator)
20211485 Methylation status of CIDEA, HAAO and RXFP3 had significant association with microsatellite instability in endometrial tumors.
19724865 GTF2A1 alone, or GTF2A1 plus HAAO are excellent candidate biomarkers for detecting Ovarian cancer
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MERRLGVRAWVKENRGSFQPPVCNKLMHQEQLKVMFIGGPNTRKDYHIEEGEEVFYQLEGDMVLRVLEQG      1 - 70
KHRDVVIRQGEIFLLPARVPHSPQRFANTVGLVVERRRLETELDGLRYYVGDTMDVLFEKWFYCKDLGTQ     71 - 140
LAPIIQEFFSSEQYRTGKPIPDQLLKEPPFPLSTRSIMEPMSLDAWLDSHHRELQAGTPLSLFGDTYETQ    141 - 210
VIAYGQGSSEGLRQNVDVWLWQLEGSSVVTMGGRRLSLAPDDSLLVLAGTSYAWERTQGSVALSVTQDPA    211 - 280
CKKPLG                                                                    281 - 286
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20468071 2010 Evidence for genes on chromosome 2 contributing to alcohol dependence with conduct disorder and suicide attempts.
20211485 2010 Promoter hypermethylation of CIDEA, HAAO and RXFP3 associated with microsatellite instability in endometrial carcinomas.
19724865 2009 Identification of candidate epigenetic biomarkers for ovarian cancer detection.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14704851 2004 Enzymology of NAD+ homeostasis in man.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12007609 2002 Cloning of human 3-hydroxyanthranilic acid dioxygenase in Escherichia coli: characterisation of the purified enzyme and its in vitro inhibition by Zn2+.
9291104 1997 Different kynurenine pathway enzymes limit quinolinic acid formation by various human cell types.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7514594 1994 Molecular cloning and functional expression of human 3-hydroxyanthranilic-acid dioxygenase.
2967497 1988 3-Hydroxyanthranilate oxygenase activity is increased in the brains of Huntington disease victims.