Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession H7C350
Symbols

Gene

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Mouse EggNOG Inparanoid
Dog OMA EggNOG

AA Sequence

MEGLKTLGPCGHPHPQCPPTPASSSHGGGLDQPCQGFVGWPCLGPISSAHSVQSQRPFPVPGAGGSGPTV      1 - 70
EGEAPGLFLSSQEQRARDTEGPRQGDLEAGLGWGWPLHPGSNQGAPRQGGSIGSGTRPCPCPPLSREGGA     71 - 140
LASPRVALSQLQCGLLGSAEQSFLQLEQENHSLKRQNQELREQLGALLGPGQQFLPLCPEHSSCTALAWP    141 - 210
PDPAGTQPLGNRAPLQLLRRELCQGQEAFVQQSQNELQQIRLCFERKKMVITEVWDNVAEMHMALNNQAT    211 - 280
GLLNLKKDIRGVLDQMEDIQLEILRERAQCRTRARKEKQMASMSKGRPKLGSSKGLAGQLWLLTLRLLLG    281 - 350
ALLVWTAAYVYVVNPTPFEGLVPPLLSRATVWKLRALLDPFLRLKVDGFLPF                      351 - 402
//

Text Mined References (1)

PMID Year Title
10591208 1999 The DNA sequence of human chromosome 22.