Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession H7BZ55
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MSSASSEPGNGDASQQPLLGLDTVIQRLEDTILSPTASREDRALTVRGEGRQASPTPVPTRIREIVAGSL      1 - 70
SEEPPQAGVQEPTATVARVQEENELLQEELTRLGDLLAQASAERDELASRCRVVSEQLQARLETTEAQLR     71 - 140
RSELEHSVDLEEALGRLEAAEERSTGLCQVNALLREQLEHMKKANDALGRELAGMTGSVQRLQGELELRR    141 - 210
WAQRQTRSGGLGQPRDLLLLWRQAVVLGTDLAELRVATERGLADLQADTARTARRLHTACLNLDSNLRLS    211 - 280
ASSTASTLGQQLRDKAGEMLQLQGRWDAEKVALQARLSEQTLLVEKLTEQNEQKAKTIAALRTDLQNLVA    281 - 350
QEDARCLELAGSSITELGEPRRPLRSPQRATSPHQGASPPHICSPATLDPALQAMRAAIERRWRREQELC    351 - 420
LQLKSSQALVASLQEQLSESRRELWAAQKLQQERAREQAREREALRGQLEAQRLEVQQCRASCKLLGREK    421 - 490
AALEMVVEELKGKADAADAEKQGLEAEAAELQRSLLLQAERREELALRRERSCRALETSQGRLQQLEEKV    491 - 560
SGLREELASVREALSTAQLQRDVVESEREGLRSALARAECSNADLELLVRRLKSEGVEQRDSLAAMAALM    561 - 630
EGLAQDKSALNHLALQLEQERDQLREQRKTLEQERARAGEQLAQAEQQLALERAERRGLQQACGRLEQRQ    631 - 700
EQLEGQAALLGREKAQLQEQVGQVTCQKQALEEQLAQSLQDQEAQMGTLQQALQGKDALSEERAQLLAKQ    701 - 770
EALERQGRLAAEEAADLRVERDSLESSLLEAQQLATKLQEQLEEEARSAGLARQALQVEMEQLQSDWEVQ    771 - 840
EMKLRQDTVRLQRQVAQQEREAQRALESQALAHREALAQLQREKETLSLTLAEEKEVARCQLEQEKELVT    841 - 910
KSAAEREALKGEIQSLKQERDESLLQLEHKMQQVMALSLKETERSLLSEELSRARRTLERVQQEAQSQQE    911 - 980
QAQATISATTEELKALQAQFEDAITAHQRETTALRESLQDLAAERGDVEREAERLRAQLTVAQEGLAALR    981 - 1050
QELQGVEESREGLHREAQEARRALSDEAREKDVLLLFNSELRATICRAEQEKASFKRSKEEKEQKLLILE   1051 - 1120
EAQAALQQEASALRAHLWELEQAGGDARQELRELHRQVRTLKAENQRRSGEAHELQAQCSQEVLELRRQA   1121 - 1190
AKAEAKHEGARKEVLGLQRKLAEVEAAGEAHGQRLQEHLRESRGAEQTLRAELHSVTRKLQEASGVADAL   1191 - 1260
QARLDQACHRIHSLEQELAQAEGARQDAEAQLGRLCSTLRRGLGLQRQSPWASPEQPGSPTKGSDSSQAL   1261 - 1330
PGQQGTSPPARPHSPLRWPSPTPGGRSSELMDVATVQDILRDFVQKLREAQRERDDSRIQMATLSSRLSE   1331 - 1400
AECRCARAQSRVGQLQKALAEAEEGQRRVEGALSSARAARALQKEALRRLELEHLASVRAAGQEKRRLQE   1401 - 1470
QLETLRQALEESRRHSQGLAKQGKLLEEQLTNLEHRCQKAEVSLEPLRQMEQETLKREEDVARLGAEKEQ   1471 - 1540
LDQSLNSLHQEVDGALRQNQQLQAQMTEMEQAHTQRLQDLTAQHQRDLATEAERLHGARPQATQALESQE   1541 - 1610
WTHQQQVKVLEEQVASLKEQLDQEVQWRQQAHLGQAFQTGHAQRD                            1611 - 1655
//

Text Mined References (3)

PMID Year Title
23044541 2012 Pinstripe: a suite of programs for integrating transcriptomic and proteomic datasets identifies novel proteins and improves differentiation of protein-coding and non-coding genes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.