Property Summary

NCBI Gene PubMed Count 44
PubMed Score 169.72
PubTator Score 439.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.500 9.8e-05
Astrocytoma, Pilocytic 1.500 1.5e-08
atypical teratoid / rhabdoid tumor 1.100 1.1e-04
cutaneous lupus erythematosus -1.400 1.1e-02
cystic fibrosis 1.254 9.2e-05
diabetes mellitus -1.100 1.9e-02
ependymoma 1.100 5.5e-12
glioblastoma 1.300 4.1e-07
medulloblastoma, large-cell 1.200 1.4e-03
ovarian cancer -2.000 1.7e-12
pancreatic ductal adenocarcinoma liver m... -1.219 7.3e-04

Gene RIF (34)

AA Sequence

MWNMLIVAMCLALLGCLQAQELQGHVSIILLGATGDLAKKYLWQGLFQLYLDEAGRGHSFSFHGAALTAP      1 - 70
KQGQELMAKALESLSCPKDMAPSHCAEHKDQFLQLSQYRQLKTAEDYQALNKDIEAQLQHAGLREAGRIF     71 - 140
YFSVPPFAYEDIARNINSSCRPGPGAWLRVVLEKPFGHDHFSAQQLATELGTFFQEEEMYRVDHYLGKQA    141 - 210
VAQILPFRDQNRKALDGLWNRHHVERVEIIMKETVDAEGRTSFYEEYGVIRDVLQNHLTEVLTLVAMELP    211 - 280
HNVSSAEAVLRHKLQVFQALRGLQRGSAVVGQYQSYSEQVRRELQKPDSFHSLTPTFAAVLVHIDNLRWE    281 - 350
GVPFILMSGKALDERVGYARILFKNQACCVQSEKHWAAAQSQCLPRQLVFHIGHGDLGSPAVLVSRNLFR    351 - 420
PSLPSSWKEMEGPPGLRLFGSPLSDYYAYSPVRERDAHSVLLSHIFHGRKNFFITTENLLASWNFWTPLL    421 - 490
ESLAHKAPRLYPGGAENGRLLDFEFSSGRLFFSQQQPEQLVPGPGPAPMPSDFQVLRAKYRESPLVSAWS    491 - 560
EELISKLANDIEATAVRAVRRFGQFHLALSGGSSPVALFQQLATAHYGFPWAHTHLWLVDERCVPLSDPE    561 - 630
SNFQGLQAHLLQHVRIPYYNIHPMPVHLQQRLCAEEDQGAQIYAREISALVANSSFDLVLLGMGADGHTA    631 - 700
SLFPQSPTGLDGEQLVVLTTSPSQPHRRMSLSLPLINRAKKVAVLVMGRMKREITTLVSRVGHEPKKWPI    701 - 770
SGVLPHSGQLVWYMDYDAFLG                                                     771 - 791
//

Text Mined References (49)

PMID Year Title