Property Summary

NCBI Gene PubMed Count 50
PubMed Score 122.49
PubTator Score 12.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Breast cancer -2.700 2.8e-24
Atopic dermatitis -1.500 1.7e-05
atypical teratoid / rhabdoid tumor -1.700 5.5e-05
breast carcinoma -1.200 3.9e-23
colon cancer -2.300 2.1e-04
cutaneous lupus erythematosus -1.800 1.0e-03
Down syndrome 1.100 9.9e-04
group 3 medulloblastoma 1.700 2.8e-03
hepatocellular carcinoma -1.300 1.4e-05
invasive ductal carcinoma -1.640 5.3e-06
lung adenocarcinoma -1.630 1.2e-06
lung cancer -1.900 7.1e-04
malignant mesothelioma 1.400 6.2e-07
Multiple myeloma 1.768 8.9e-03
non-small cell lung cancer -1.978 1.4e-23
ovarian cancer -2.100 1.0e-05
pancreatic cancer -1.100 4.6e-04
pancreatic carcinoma -1.100 4.6e-04
pituitary cancer 1.400 6.8e-06
psoriasis -1.100 4.3e-05
subependymal giant cell astrocytoma -1.720 1.4e-02
tuberculosis and treatment for 6 months 1.200 3.3e-06

Protein-protein Interaction (1)

PDB (44)

Gene RIF (10)

AA Sequence

MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR      1 - 70
LVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA         71 - 136
//

Text Mined References (105)

PMID Year Title