Property Summary

NCBI Gene PubMed Count 44
PubMed Score 100.60
PubTator Score 12.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
hepatocellular carcinoma -1.300 1.4e-05
pancreatic cancer -1.100 4.6e-04
Multiple myeloma 1.768 8.9e-03
malignant mesothelioma 1.400 6.2e-07
psoriasis -1.100 4.3e-05
cutaneous lupus erythematosus -1.800 1.0e-03
group 3 medulloblastoma 1.700 2.8e-03
atypical teratoid/rhabdoid tumor -2.000 4.8e-07
Atopic dermatitis -1.500 1.7e-05
tuberculosis and treatment for 6 months 1.200 3.3e-06
non-small cell lung cancer -1.978 1.4e-23
lung cancer -2.900 2.9e-05
colon cancer -2.300 2.1e-04
pancreatic carcinoma -1.100 4.6e-04
subependymal giant cell astrocytoma -1.720 1.4e-02
invasive ductal carcinoma -1.640 5.3e-06
lung adenocarcinoma -1.630 1.2e-06
Breast cancer -2.700 2.8e-24
breast carcinoma -1.200 3.9e-23
ovarian cancer -2.100 1.0e-05
pituitary cancer 1.400 6.8e-06
Down syndrome 1.100 9.9e-04

Gene RIF (9)

PMID Text
26457357 H3F3A and H3F3B mutation analysis appears to be a highly specific, although less sensitive, diagnostic tool for the distinction of GCTB and chondroblastoma from other giant cell-containing tumors.
24162739 A remarkable picture of tumor type specificity for histone H3.3 driver alterations emerges, indicating that histone H3.3 residues, mutations and genes have distinct functions.
22174317 HIV-1 Rev interacting protein, H3 histone, family 3B (H3F3B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
20504901 DAXX functions as a bona fide histone chaperone involved in the replication-independent deposition of H3.3
18760861 HIV-1 Rev interacting protein, H3 histone, family 3B (H3F3B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
14657027 HIV-1 Rev interacting protein, H3 histone, family 3B (H3F3B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
11689053 HIV-1 Rev interacting protein, H3 histone, family 3B (H3F3B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
11080476 HIV-1 Rev interacting protein, H3 histone, family 3B (H3F3B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
9566873 HIV-1 Rev interacting protein, H3 histone, family 3B (H3F3B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR      1 - 70
LVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA         71 - 136
//

Text Mined References (87)

PMID Year Title
26457357 2015 Mutation Analysis of H3F3A and H3F3B as a Diagnostic Tool for Giant Cell Tumor of Bone and Chondroblastoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25615412 2015 Human tNASP promotes in vitro nucleosome assembly with histone H3.3.
25416956 2014 A proteome-scale map of the human interactome network.
25245173 2015 Getting rhythm: how do babies do it?
24590075 2014 ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24183680 2013 Reduced H3K27me3 and DNA hypomethylation are major drivers of gene expression in K27M mutant pediatric high-grade gliomas.
24162739 2013 Distinct H3F3A and H3F3B driver mutations define chondroblastoma and giant cell tumor of bone.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23415232 2013 Regulation of transcription through acetylation of H3K122 on the lateral surface of the histone octamer.
22483618 2012 Lysyl oxidase-like 2 deaminates lysine 4 in histone H3.
22387026 2012 Histone H3 lysine 56 methylation regulates DNA replication through its interaction with PCNA.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
21636898 2011 Structures of human nucleosomes containing major histone H3 variants.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21274551 2011 H3.5 is a novel hominid-specific histone H3 variant that is specifically expressed in the seminiferous tubules of human testes.
20953165 2010 A phospho/methyl switch at histone H3 regulates TFIID association with mitotic chromosomes.
20850016 2010 Quantitative interaction proteomics and genome-wide profiling of epigenetic histone marks and their readers.
20651253 2010 Daxx is an H3.3-specific histone chaperone and cooperates with ATRX in replication-independent chromatin assembly at telomeres.
20504901 2010 The death-associated protein DAXX is a novel histone chaperone involved in the replication-independent deposition of H3.3.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20448663 2010 PELP1 is a reader of histone H3 methylation that facilitates oestrogen receptor-alpha target gene activation by regulating lysine demethylase 1 specificity.
20228790 2010 Phosphorylation of histone H3T6 by PKCbeta(I) controls demethylation at histone H3K4.
20110566 2010 ATRX interacts with H3.3 in maintaining telomere structural integrity in pluripotent embryonic stem cells.
19834512 2009 Structural basis for recognition of H3K4 methylation status by the DNA methyltransferase 3A ATRX-DNMT3-DNMT3L domain.
19783980 2009 JAK2 phosphorylates histone H3Y41 and excludes HP1alpha from chromatin.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19633671 2009 H3.3/H2A.Z double variant-containing nucleosomes mark 'nucleosome-free regions' of active promoters and other regulatory regions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19520870 2009 Acetylation of histone H3 at the nucleosome dyad alters DNA-histone binding.
19494831 2009 Molecular recognition of histone lysine methylation by the Polycomb group repressor dSfmbt.
19135898 2009 Purification of proteins associated with specific genomic Loci.
18079182 2007 PRMT6-mediated methylation of R2 in histone H3 antagonizes H3 K4 trimethylation.
18077460 2008 Arginine methylation of the histone H3 tail impedes effector binding.
18066052 2008 Phosphorylation of histone H3 at threonine 11 establishes a novel chromatin mark for transcriptional regulation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17898714 2007 Methylation of histone H3R2 by PRMT6 and H3K4 by an MLL complex are mutually exclusive.
17675446 2007 A charge-based interaction between histone H4 and Dot1 is required for H3K79 methylation and telomere silencing: identification of a new trans-histone pathway.
17194708 2007 Organismal differences in post-translational modifications in histones H3 and H4.
17189264 2007 Identification of histone H3 lysine 36 acetylation as a highly conserved histone modification.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16567635 2006 Structural basis for histone N-terminal recognition by human peptidylarginine deiminase 4.
16497732 2006 Coactivator-associated arginine methyltransferase-1 enhances nuclear factor-kappaB-mediated gene transcription through methylation of histone H3 at arginine 17.
16457588 2006 Mass spectrometric characterization of human histone H3: a bird's eye view.
16381901 2006 The LIFEdb database in 2006.
16267050 2006 Expression patterns and post-translational modifications associated with mammalian histone H3 variants.
16258499 2006 Histone H3.3 deposition at E2F-regulated genes is linked to transcription.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16185088 2005 Modifications of human histone H3 variants during mitosis.
15851689 2005 Serine 31 phosphorylation of histone variant H3.3 is specific to regions bordering centromeres in metaphase chromosomes.
15776021 2005 Variant histone H3.3 marks promoters of transcriptionally active genes during mammalian cell division.
15684425 2005 Phosphorylation of Ser28 in histone H3 mediated by mixed lineage kinase-like mitogen-activated protein triple kinase alpha.
15681610 2005 The kinase haspin is required for mitotic histone H3 Thr 3 phosphorylation and normal metaphase chromosome alignment.
15525939 2004 Methylated lysine 79 of histone H3 targets 53BP1 to DNA double-strand breaks.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471871 2004 Ligand-dependent activation of the farnesoid X-receptor directs arginine methylation of histone H3 by CARM1.
15345777 2004 Human PAD4 regulates histone arginine methylation levels via demethylimination.
14718166 2004 Histone H3.1 and H3.3 complexes mediate nucleosome assembly pathways dependent or independent of DNA synthesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14657027 2003 Regulation of HIV-1 gene expression by histone acetylation and factor recruitment at the LTR promoter.
14527345 2003 A functional genomic analysis of cell morphology using RNA interference.
12909349 2003 Differential expression of human replacement and cell cycle dependent H3 histone genes.
12560483 2003 Novel mitosis-specific phosphorylation of histone H3 at Thr11 mediated by Dlk/ZIP kinase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11856369 2002 Aurora-B phosphorylates Histone H3 at serine28 with regard to the mitotic chromosome condensation.
11751582 2002 Methylation at arginine 17 of histone H3 is linked to gene activation.
11689053 2001 Enhancement of the p300 HAT activity by HIV-1 Tat on chromatin DNA.
11242053 2001 Methylation of histone H3 lysine 9 creates a binding site for HP1 proteins.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11080476 2000 Acetylation of HIV-1 Tat by CBP/P300 increases transcription of integrated HIV-1 genome and enhances binding to core histones.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10464286 1999 Identification of a novel phosphorylation site on histone H3 coupled with mitotic chromosome condensation.
10096020 1998 Tip60 acetylates six lysines of a specific class in core histones in vitro.
9731536 1998 HIRA, a mammalian homologue of Saccharomyces cerevisiae transcriptional co-repressors, interacts with Pax3.
9566873 1998 Transcriptional activation of the integrated chromatin-associated human immunodeficiency virus type 1 promoter.
9188772 1997 Transcriptional regulation of the human replacement histone gene H3.3B.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8586426 1995 The human replacement histone H3.3B gene (H3F3B).
7557364 1995 Structure and expression of histone H3.3 genes in Drosophila melanogaster and Drosophila hydei.
7309716 1981 Human spleen histone H3. Isolation and amino acid sequence.
3031613 1987 Unusual structure, evolutionary conservation of non-coding sequences and numerous pseudogenes characterize the human H3.3 histone multigene family.
2859593 1985 Structure of a human histone cDNA: evidence that basally expressed histone genes have intervening sequences and encode polyadenylylated mRNAs.
1748304 1991 A Drosophila melanogaster H3.3 cDNA encodes a histone variant identical with the vertebrate H3.3.