Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession H3BSY2 A6NCM5 F8WBD5
Symbols

Gene

PANTHER Protein Class (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MAEETQHNKLAAAKKKLKEYWQKNSPRVPAGANRNRKTNGSIPQTATSGGCQPPGDSATGFHREGPTSSA      1 - 70
TLKDLESPCQERAVVLDSRSVEISQLKNTIKSLKQQKKQVEHQLEEEKKANNKKQKAKRVLEVQLQTLNI     71 - 140
QKEELNTDLYHMKRSLRYFEEKSKDLAVRLQHSLQRKGELESVLSDVMATQKKKANQLSSPSKAGTEWKL    141 - 210
EQSMREEALLKVQLTQLKESFQQVQLERDEYSEHLKGERARWQQRMRKMSQEICTLKKEKQQDMRRVEKL    211 - 280
ERSLSKLKNQMAEPLPPEPPAVPSEVELQHLRKELERVAGELQAQVKNNQRISLLNQRQEERIREQEERL    281 - 350
RKQEERIQEQHKSLQQLAKPQSVFEEPNNENKSTLQLEQQVKELQEKLGEEHLEAASQQNQQLTAQLSLM    351 - 420
ALPGEGHGGEHLDSEGEEAPQPMPSVPEDPESREAMSSFMDHLEEKADLSELVKKQELRFIQYWQERCHQ    421 - 490
KIHHLLSEPGGRAKDAALGGGHHQAGAQGGDEGEAAGAAADGIAAYSNYNNGHRKFLAAAHNSADEPGPG    491 - 560
APAPQELGAADKHGDLCEVSLTSSAQGEAREDPLLDKPTAQPIVQDHQEHPGLGSNCCVPFFCWAWLPRR    561 - 630
RR                                                                        631 - 632
//

Text Mined References (2)

PMID Year Title
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.