Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.8e-46
ependymoma 4679 3.7e-05
atypical teratoid / rhabdoid tumor 5112 3.4e-03
glioblastoma 5792 1.4e-02
medulloblastoma, large-cell 6241 2.6e-02
Disease Target Count Z-score Confidence
skin melanoma 14 3.265 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -2.400 3.4e-03
ependymoma -1.100 3.7e-05
glioblastoma -1.100 1.4e-02
medulloblastoma, large-cell -1.100 2.6e-02
psoriasis -1.400 3.8e-46

Gene RIF (1)

AA Sequence

MAAGRLLLYTGLSLALCALGMLAVAICSDHWYETDARKHRDRCKAFNTRRVDPGFIYNNNNNLPLRASRS      1 - 70
RLDRWEGKLLRARNRRQLFAMSPADECSRQYNSTNMGLWRKCHRQGFDPEIAALIRKGEIERCTYIKYHY     71 - 140
SSATIPRNLTFNITKTIRQDEWHALHLRRMTAGFMGMAVAIILFGWIIGVLGCCWDRGLMQYVAGLLFLM    141 - 210
GGTFCIISLCTCVAGINFELSRYPRYLYGLPDDISHGYGWSMFCAWGGLGLTLISGFFCTLAPSVQPVPR    211 - 280
TNYPKSRPENGTVC                                                            281 - 294
//

Text Mined References (7)

PMID Year Title