Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma -1.100 0.000
atypical teratoid / rhabdoid tumor -2.400 0.003
glioblastoma -1.100 0.014
medulloblastoma, large-cell -1.100 0.026
psoriasis -1.400 0.000

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAAGRLLLYTGLSLALCALGMLAVAICSDHWYETDARKHRDRCKAFNTRRVDPGFIYNNNNNLPLRASRS      1 - 70
RLDRWEGKLLRARNRRQLFAMSPADECSRQYNSTNMGLWRKCHRQGFDPEIAALIRKGEIERCTYIKYHY     71 - 140
SSATIPRNLTFNITKTIRQDEWHALHLRRMTAGFMGMAVAIILFGWIIGVLGCCWDRGLMQYVAGLLFLM    141 - 210
GGTFCIISLCTCVAGINFELSRYPRYLYGLPDDISHGYGWSMFCAWGGLGLTLISGFFCTLAPSVQPVPR    211 - 280
TNYPKSRPENGTVC                                                            281 - 294
//

Text Mined References (6)

PMID Year Title
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
9847074 1998 Toward a complete human genome sequence.