Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.6e-09

Synonym

Accession H3BNL1
Symbols

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG

 Compartment GO Term (0)

 GWAS Trait (1)

 HCA RNA Cell Line (1)

AA Sequence

MQSALVGSWHNNGFYGHYRSQFKSESAREYHLAAKPQPPAVFLQRCQEPAQRHFFSKHDNRTSFDKGPYC      1 - 70
LLQGIGRRKDLERLWQRHTFLRWAPCEIELRQQGPLESSYQADFRPGPGLSGLPQHLIHFVQVQPSHTRT     71 - 140
TYQQNFCCPSQGGHYGSYKVGPQAPVTDVLPDLPGIPRPKLLQHYLHAGVSECLNWSRALNKDS          141 - 204
//

Text Mined References (1)

PMID Year Title