Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.08

Knowledge Summary

Patent

No data available

Synonym

Accession H3BN30
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MKKWKSRLFPRPPNWLSGKYLRLPSSAMFLIDFCLCVPWTTPFQCKILMVEFIVGFYDFCLALEVQYRTS      1 - 70
KLFLCGQPSPRRSLGIQQQALKLACLSPTLLESSSCVDPPGNTAGSRMPSSSNCIK                   71 - 126
//

Text Mined References (2)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
11181995 2001 The sequence of the human genome.