Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -2.200 0.008
oligodendroglioma -1.800 0.033
atypical teratoid / rhabdoid tumor -1.100 0.033
glioblastoma -1.900 0.001
medulloblastoma -1.500 0.013
medulloblastoma, large-cell -1.800 0.013
pediatric high grade glioma -1.300 0.006
pilocytic astrocytoma -1.800 0.000
posterior fossa group B ependymoma 1.200 0.005
invasive ductal carcinoma 1.200 0.039

Synonym

Accession H3BMG3
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MPAKGKKGKGQGKSHGKKQKKPEVDILSPAAMLNLYYIAHNVADCLHLRGFHWPGAPKGKKGRSK           1 - 65
//

Text Mined References (2)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.