Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.300 3.5e-02
astrocytic glioma -2.200 8.2e-03
Astrocytoma, Pilocytic -1.800 6.5e-05
atypical teratoid / rhabdoid tumor -1.100 3.3e-02
glioblastoma -1.900 6.8e-04
invasive ductal carcinoma 1.200 3.9e-02
medulloblastoma -1.500 1.3e-02
medulloblastoma, large-cell -1.800 1.3e-02
oligodendroglioma -1.800 3.3e-02
posterior fossa group B ependymoma 1.200 5.3e-03

AA Sequence

MPAKGKKGKGQGKSHGKKQKKPEVDILSPAAMLNLYYIAHNVADCLHLRGFHWPGAPKGKKGRSK           1 - 65
//

Text Mined References (2)

PMID Year Title