Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.83
PubTator Score 6.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer 1.200 5.9e-09
cutaneous lupus erythematosus -1.200 4.8e-03
group 4 medulloblastoma 3.100 3.0e-06
malignant mesothelioma -2.500 3.9e-06
nasopharyngeal carcinoma -1.400 8.7e-07
non-small cell lung cancer -1.040 6.1e-16
osteosarcoma -2.159 1.5e-04
ovarian cancer 1.800 2.3e-05
posterior fossa group A ependymoma 1.100 1.1e-05
psoriasis -1.300 6.0e-07

Gene RIF (7)

AA Sequence

MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNA      1 - 70
ARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESQKTKSK                71 - 129
//

Text Mined References (17)

PMID Year Title