Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.36
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Gene RIF (5)

AA Sequence

MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLEL      1 - 70
AGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED                              71 - 115
//

Text Mined References (16)

PMID Year Title