Property Summary

NCBI Gene PubMed Count 9
PubMed Score 12.47
PubTator Score 15.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6

Expression

Gene RIF (2)

AA Sequence

MEQALTGEAQSRWPRRGGSGAMAEAPGPSGESRGHSATQLPAEKTVGGPSRGCSSSVLRVSQLVLQAIST      1 - 70
HKGLTLAALKKELRNAGYEVRRKSGRHEAPRGQAKATLLRVSGSDAAGYFRVWKVPKPRRKPGRARQEEG     71 - 140
TRAPWRTPAAPRSSRRRRQPLRKAARKAREVWRRNARAKAKANARARRTRRARPRAKEPPCARAKEEAGA    141 - 210
TAADEGRGQAVKEDTTPRSGKDKRRSSKPREEKQEPKKPAQRTIQ                             211 - 255
//

Text Mined References (11)

PMID Year Title