Property Summary

NCBI Gene PubMed Count 30
PubMed Score 2030.29
PubTator Score 367.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.700 2.6e-07
oligodendroglioma 1.100 4.2e-02
astrocytoma 1.500 2.5e-02
ulcerative colitis -1.043 3.1e-02
non-small cell lung cancer 1.196 1.4e-14
intraductal papillary-mucinous neoplasm ... 1.600 2.3e-02
lung cancer 1.100 1.4e-03
lung adenocarcinoma 1.200 3.0e-04
ovarian cancer 1.800 3.3e-04
head and neck cancer -1.100 9.4e-08

Protein-protein Interaction (5)

Gene RIF (4)

PMID Text
22334665 The N-terminal domain contributes toward the differential chromatin binding affinity, whereas the C-terminal domain contributes toward distinct nucleosomal interface of isotypes H10 and H1c.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
12149419 H1(0)histone may be an important factor in normal DC differentiation. Tumor-derived factors may inhibit DC differentiation by affecting H1(0) expression.
12080050 nuclear transport of H1 histones requires a heterodimeric nuclear import receptor

AA Sequence

MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKL      1 - 70
SIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKA     71 - 140
TPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK                    141 - 194
//

Text Mined References (34)

PMID Year Title
26689747 2016 Role of H1 linker histones in mammalian development and stem cell differentiation.
24614311 2014 Every amino acid matters: essential contributions of histone variants to mammalian development and disease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22334665 2012 N- and C-terminal domains determine differential nucleosomal binding geometry and affinity of linker histone isotypes H1(0) and H1c.
21269460 2011 Initial characterization of the human central proteome.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
19882353 2010 Histone H1 subtype preferences of DFF40 and possible nuclear localization of DFF40/45 in normal and trichostatin A-treated NB4 leukemic cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18993075 2008 Evidence for insertional RNA editing in humans.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15911621 2005 H1 family histones in the nucleus. Control of binding and localization by the C-terminal domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14595808 2003 Identification of chromatin-related protein interactions using protein microarrays.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12406094 2002 Developmental changes in the expression of transcription factors GATA-1, -2 and -3 during the onset of human medullary haematopoiesis.
12149419 2002 H1(0) histone and differentiation of dendritic cells. A molecular target for tumor-derived factors.
12080050 2002 The requirement of H1 histones for a heterodimeric nuclear import receptor.
10591208 1999 The DNA sequence of human chromosome 22.
10529182 1999 Sequence preference of mouse H1(0) and H1t.
10471283 1999 Ultraviolet laser footprinting of histone H1(0)-four-way junction DNA complexes.
10228156 1999 The importin beta/importin 7 heterodimer is a functional nuclear import receptor for histone H1.
9770363 1998 The histone H1(0) contains multiple sequence elements for nuclear targeting.
9582379 1998 The microheterogeneity of the mammalian H1(0) histone. Evidence for an age-dependent deamidation.
9499053 1998 Association of the human papillomavirus type 11 E1 protein with histone H1.
8325638 1993 All known human H1 histone genes except the H1(0) gene are clustered on chromosome 6.
7511470 1993 Fractionation of human H1 subtypes and characterization of a subtype-specific antibody exhibiting non-uniform nuclear staining.
7374750 1980 Histone H10 accumulates in growth-inhibited cultured cells.
4595808 1974 Preservation and transplantation of human cadaver kidneys. Experiences with the Gamgro perfusion unit.
3084796 1986 Differential distribution of lysine and arginine residues in the closely related histones H1 and H5. Analysis of a human H1 gene.