Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
tuberculosis and treatment for 6 months 686

Expression

  Differential Expression (1)

Disease log2 FC p
tuberculosis and treatment for 6 months -1.100 0.005

Gene RIF (1)

PMID Text
21667337 This study examined host cell protein C9orf69, which promotes viral proliferation via interaction with HSV-1 UL25 protein.

AA Sequence

MPVMPIPRRVRSFHGPHTTCLHAACGPVRASHLARTKYNNFDVYIKTRWLYGFIRFLLYFSCSLFTAALW      1 - 70
GALAALFCLQYLGVRVLLRFQRKLSVLLLLLGRRRVDFRLVNELLVYGIHVTMLLVGGLGWCFMVFVDM      71 - 139
//

Text Mined References (6)

PMID Year Title
21667337 2011 Host cell protein C9orf69 promotes viral proliferation via interaction with HSV-1 UL25 protein.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.