Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.43

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession H0YL09
Symbols

Gene

PANTHER Protein Class (1)

 Compartment GO Term (0)

AA Sequence

MGPAVLGQGQEGQPEARACSGLLQPPKRPIVFKEKLTMKTDSLMEEKLECSLWCCLSDPSIPGRCCVLER      1 - 70
RIVPWMQQESYSSSSPIWSVDSDEPNLTSVLERLEDTKENSSVRKETKLFSLFLMNIIFRN              71 - 131
//

Text Mined References (1)

PMID Year Title
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.