Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession H0Y354
Symbols

Gene

Gene RIF (1)

PMID Text
26206078 An epistemological characterization of the human tumorigenic neuronal paralogous FAM72 gene loci (FAM72A, FAM72B, FAM72C, FAM72D).

AA Sequence

MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLK      1 - 70
DIACLKCGNIVVYHVIVPCSSCLLSCNNRHFWMFHSQAVYDINRLDSTGVNVLLRGNLPEIEESTDEDVL     71 - 140
NISAEECIR                                                                 141 - 149
//

Text Mined References (2)

PMID Year Title
26206078 2015 All-or-(N)One - an epistemological characterization of the human tumorigenic neuronal paralogous FAM72 gene loci.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.