Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession H0UI37
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MKIEKCGWSEGLTSIKGNCHNFYTAISKDVTYKELKNLLNSKNIMLIDVREIWEILEYQKIPESINVPLD      1 - 70
EVGEALQMNPRDFKEKYNEVKPSKSDS                                                71 - 97
//

Text Mined References (2)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.