Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession H0UI37
Symbols

Gene

  Ortholog (2)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid

 Compartment GO Term (0)

AA Sequence

MKIEKCGWSEGLTSIKGNCHNFYTAISKDVTYKELKNLLNSKNIMLIDVREIWEILEYQKIPESINVPLD      1 - 70
EVGEALQMNPRDFKEKYNEVKPSKSDS                                                71 - 97
//

Text Mined References (2)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.