Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0

Expression

Synonym

Accession H0UI37
Symbols

Gene

  Ortholog (2)

 Compartment GO Term (0)

AA Sequence

MKIEKCGWSEGLTSIKGNCHNFYTAISKDVTYKELKNLLNSKNIMLIDVREIWEILEYQKIPESINVPLD      1 - 70
EVGEALQMNPRDFKEKYNEVKPSKSDS                                                71 - 97
//

Text Mined References (2)

PMID Year Title