Property Summary

NCBI Gene PubMed Count 21
PubMed Score 118.99
PubTator Score 31.81

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MTKFSSFSLFFLIVGAYMTHVCFNMEIIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQY      1 - 70
RFTKGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSK     71 - 140
TSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSC    141 - 210
KGDSGGPLICKGVFHAIVSGGHECGVATKPGIYTLLTKKYQTWIKSNLVPPHTN                    211 - 264
//