Property Summary

NCBI Gene PubMed Count 24
PubMed Score 65.76
PubTator Score 38.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
cutaneous lupus erythematosus 2.200 3.1e-04
psoriasis 1.300 1.2e-02
osteosarcoma -3.086 2.3e-03
tuberculosis 1.700 8.2e-05
non-small cell lung cancer -1.596 7.1e-13
Common variable immunodeficiency 1.678 6.5e-03
intraductal papillary-mucinous carcinoma... -1.100 3.5e-04
lung cancer -1.400 7.9e-04
interstitial cystitis 1.800 1.8e-02
lung adenocarcinoma -1.952 6.7e-15
nasopharyngeal carcinoma 1.100 9.7e-03
type I diabetes mellitus -1.179 1.3e-02
head and neck cancer and chronic obstruc... 1.100 4.0e-02

Gene RIF (14)

PMID Text
23352961 Granzyme H did directly process DFF45, potentially leading to DNA damage.
23269243 Upon reactive center loop cleavage at Phe-343,SERPINB1 covalently complexes with GzmH. SERPINB1 overexpression suppresses GzmH- or LAK cell-mediated cytotoxicity. Crystal structures show possible conformational changes in GzmH for the suicide inhibition.
22156497 An unusual RKR motif (Arg39-Lys40-Arg41), conserved only in GzmH, helps define the S3' and S4' binding regions, indicating the preference for acidic residues at the P3' and P4' sites.
22156339 GzmH suppresses viral replication through association with the hepatitis B virus x protein.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19039329 Cleavage of La protein by granzyme H generates a COOH-terminal truncated form of La protein that loses nuclear localization and decreases hepatitis C virus-internal ribosome entry site-mediated translational activity.
17766182 Granzyme H could have evolved a proteolytic specificity that both interferes directly with adenovirus replication and prevents the virus from blocking the potent pro-apoptotic activity of granzyme B.
17765974 GzmH may play an essential role in caspase-dependent pathogen clearance in the innate immunity that may complement the proapoptotic function of GzmB in human NK cells.
17409270 Expression levels of GzmH in naive natural killer cells and its killing ability support the role of the protease in triggering an alternative cell-death pathway in innate immunity.
17363894 Granzyme H destroys the function of critical adenoviral proteins required for viral DNA replication and granzyme B inhibition.
15069086 granzyme H complements the pro-apoptotic function of granzyme B in human NK cells
12515723 Granzyme C rapidly induces target cell death by attacking nuclear and mitochondrial targets and that these targets are distinct from those used by granzyme B to cause classical apoptosis.

AA Sequence

MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSI      1 - 70
NVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQ     71 - 140
LCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKD    141 - 210
VAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL                                      211 - 246
//

Text Mined References (25)

PMID Year Title
25342632 2014 Granzyme H is a novel protease expressed by human mast cells.
25250148 2014 Granzyme h serum levels variations with both reproductive hormone receptors, and related hormone receptors in breast cancer patients.
23352961 2013 Granzyme H induces cell death primarily via a Bcl-2-sensitive mitochondrial cell death pathway that does not require direct Bid activation.
23269243 2013 Identification of SERPINB1 as a physiological inhibitor of human granzyme H.
22156497 2012 Structural insights into the substrate specificity of human granzyme H: the functional roles of a novel RKR motif.
22156339 2012 Granzyme H of cytotoxic lymphocytes is required for clearance of the hepatitis B virus through cleavage of the hepatitis B virus X protein.
19946888 2010 Defining the membrane proteome of NK cells.
19039329 2009 Cleavage of La protein by granzyme H induces cytoplasmic translocation and interferes with La-mediated HCV-IRES translational activity.
19024195 To study the significance of apoptotic enzyme granzyme H in breast cancer patients.
17766182 2007 H is for helper: granzyme H helps granzyme B kill adenovirus-infected cells.
17765974 2008 Granzyme H induces apoptosis of target tumor cells characterized by DNA fragmentation and Bid-dependent mitochondrial damage.
17409270 2007 Natural killer cell-derived human granzyme H induces an alternative, caspase-independent cell-death program.
17363894 2007 Granzyme H destroys the function of critical adenoviral proteins required for viral DNA replication and granzyme B inhibition.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15069086 2004 Discordant regulation of granzyme H and granzyme B expression in human lymphocytes.
12515723 2003 Cell death induced by granzyme C.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10521426 1999 The human cytotoxic T cell granule serine protease granzyme H has chymotrypsin-like (chymase) activity and is taken up into cytoplasmic vesicles reminiscent of granzyme B-containing endosomes.
9920846 1999 The 5' flanking region of the human granzyme H gene directs expression to T/natural killer cell progenitors and lymphokine-activated killer cells in transgenic mice.
2402757 1990 Characterization of a novel, human cytotoxic lymphocyte-specific serine protease cDNA clone (CSP-C).
2300587 1990 A cluster of hematopoietic serine protease genes is found on the same chromosomal band as the human alpha/delta T-cell receptor locus.
2193684 1990 Cloning of a gene that encodes a new member of the human cytotoxic cell protease family.
2049336 1991 Structure and evolutionary origin of the human granzyme H gene.
2007574 1991 Structure and expression of a cluster of human hematopoietic serine protease genes found on chromosome 14q11.2.