Property Summary

NCBI Gene PubMed Count 250
PubMed Score 1890.43
PubTator Score 973.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
nephrosclerosis 1.271 3.1e-03
psoriasis 3.800 1.7e-166
cutaneous lupus erythematosus 5.000 3.3e-06
osteosarcoma -4.087 1.1e-04
Atopic dermatitis 1.300 3.7e-03
lung cancer -2.600 4.1e-03
sarcoidosis 1.300 4.6e-02
interstitial cystitis 3.100 4.7e-04
primary Sjogren syndrome 1.300 3.3e-03
nasopharyngeal carcinoma 2.000 3.0e-06
lung adenocarcinoma -2.217 1.1e-08
lung carcinoma -1.100 7.9e-10
ulcerative colitis 1.900 3.2e-03
Breast cancer 1.100 5.1e-03
head and neck cancer 2.200 1.4e-02
head and neck cancer and chronic obstruc... 1.400 4.8e-02

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (201)

PMID Text
27117663 FASL, granzyme B, and cytochrome c blood expression reflects breast cancer progression and response to therapy. (Review)
26927382 Data show that NK cell lines could secreted rapidly inactive Mr 35 000 granzyme B (GZB)outside secretory lysosomes (SLs).
26830472 Findings show that GrB was produced in 57.1% colorectal cancer cell (CRC) lines and 100% CRC-derived Cancer Stem Cells and present a novel role for GrB as up-modulator of epitelial-to-mesenchimal transition in CRC cells.
26752517 Delivered into parasite infected cells by granulysin and perforin, granzymes generate superoxide and inactivate oxidative defense enzymes to kill the parasite.
26670609 Data suggest that reactive oxygen species (ROS) generated within cytotoxic lymphocytes by receptor stimulation are required for lysosomal permeabilization and release of GzmB (granzyme B) into the cytosol and for inactivation of serpin B9.
26633185 Costimulation blockade by abatacept can decrease the serum levels of GZMB in rheumatoid arthritis patients responding to the treatment.
26610869 these results suggest a perforin-independent, extracellular role for GzmB in the pathogenesis of cardiac fibrosis
26410968 GzmB plays no role in the pathogenesis of keloids and hypertrophic scars.
26314831 Among SLAMF4+ cells, the T cell fraction positive for perforin and granzyme B was higher in those obtained from healthy donors, while the percentage of T cells that were single-positive for granzyme B was higher in cells obtained from patients with SLE.
26207425 identified among the key genes in circulating monocytes that were altered by exercise
26156785 Results reveal enhanced intra- and extracellular expression of gzmA and B in patients with pulmonary TB, suggesting that gzms are part of the host response to tuberculosis.
25780036 CD4+ T cell-derived IL-21 and deprivation of CD40 signaling favor the in vivo development of granzyme B-expressing regulatory B cells in HIV patients.
25745046 GzmA and GzmB expressing cells in the airways and lung parenchyma was higher in subjects who died from asthma
25725937 elevated in the inflammatory lesions of placentas with villitis of unknown etiology
25671296 Active secretion of CXCL10 and CCL5 from colorectal cancer microenvironments associates with granzymeB+ CD8+ T-cell infiltration.
25667415 Data indicate that treatment with toll-like receptor 8 (TLR8) agonists elicited granzyme B production.
25643139 Combined evaluation of granzyme B and perforin may have a role in noninvasive diagnosis of acute rejection after kidney transplantation.
25637022 The suppression-abrogating cytokine IL-6 augments GzmB expression by human CD4 T cells, and it inhibits Treg suppression via a nonapoptotic GzmB-mediated mechanism.
25531694 Synthetic consensus HIV-1 DNA induces potent cellular immune responses and synthesis of granzyme B, perforin in HIV infected individuals.
25404359 this study emphasizes that the coordinated action of hGzmB-activated p53 and GzmB-cleaved Bid is important for GzmB-induced cell death and for cytotoxic lymphocyte/Natural Killer Cell-mediated killing of target cells.
25367116 Polarized granzyme release is required for antigen-driven transendothelial migration of human effector memory CD4 T cells.
25361078 GB-induced ROS significantly promote apoptosis.
25313744 These results suggest that GZMB Q55R, P94A, and Y247H polymorphisms are not significantly associated with colon cancer incidence, or metastasis to lymph node and distant organ.
25245659 Activated CD4 and CD8 T cells secrete similar amounts of GrzB.
25159843 CASP is specifically cleaved by granzymeB.
25146929 PFN appears to form arc structures on target membranes that serve as minimally disrupting conduits for GzmB translocation.
24999042 These results suggest that GrzB from CCR5+ memory CD4 T cells may have a role in cellular and tissue pathologies during HIV infection.
24999042 HIV-1 infected CCR5+ memory CD4+ T cells upregulate granzyme B and HIV-1 CA production and increase the ratio of granzyme B to CA compared to infected CCR5- cells
24894428 Cancer cells released soluble factors that inhibited granzyme B, perforin and IFN-gamma production.
24875585 The results of study found implicate possible effect of this genetic polymorphism in susceptibility to SSPE which needs to be confirmed in bigger populations.
24841128 HIV-1 infected CCR5+ memory CD4+ T cells upregulate granzyme B and HIV-1 CA production and increase the ratio of granzyme B to CA compared to infected CCR5- cells
24835396 These data indicate that IBD-related inflammation is marked by mucosal accumulation of cytotoxic, GrB-expressing CD19(+) and IgA(+) cells, suggesting a role for these cells in IBD-associated epithelial damage.
24696715 our data indicate that the co-expression of perforin and granzyme B genes exhibits anticancer potential
24673566 Serum concentrations of granzyme B in patients with ovarian cancer were substantially increased in comparison to concentrations in patients with ovarian cystadenomas or ovarian teratomas.
24488096 The GrB-Sb9 nexus may therefore represent an additional mechanism of limiting lymphocyte lifespan and populations.
24355225 impaired balance between granzyme B mediated cytotoxicity and its inhibition by protease inhibitor 9 forms an important factor in the pathogenesis of villous atrophy in celiac disease.
24307760 Unlike IL-18 and FKN, plasma GZB may have a role in severity of acute coronary syndrome
24195710 multiple linear regression analysis revealed that both type 2 diabetes mellitus and central obesity were predicting factors for GzmB, findings reveal a possible role of GzmB in type 2 diabetes mellitus.
24114594 The precise role of GrzB in plasma cell biology remains to be understood and studies in mice will not help as their plasma cells do not express GrzB.
24113190 The apoptotic cell-in-cell death occurred only in internalized immune killer cells expressing granzyme B
24101526 Data indicate that hypoxia impairs breast cancer cell susceptibility to NK-mediated lysis was related to the degradation of NK-derived granzyme B in autophagosomes.
23980805 Report increased granzyme B expression in discoid lupus erythematosus.
23898208 HIV-1 infected CCR5+ memory CD4+ T cells upregulate granzyme B and HIV-1 CA production and increase the ratio of granzyme B to CA compared to infected CCR5- cells
23892923 A robust correlation was found between protease inhibitor-9 expression levels and suppression of granzyme B activity in leukemia cells.
23820889 cleaves proIL-18 into active form and promotes apoptosis in the inflammed skin
23607435 we conclude that in LTRs HCMV-specific CD8+ T cell responses, comprised not only of IFN-g secretion but also of Grz-B release, are essential for sufficient control of HCMV replication.
23598339 results suggest a mechanism for how ATP increases TrkH activity by inducing conformational changes in TrkA
23555267 Hantavirus nucleocapsid protein inhibits the enzymatic activity of both granzyme B and caspase 3 thereby protecting infected cells from cytotoxic lymphocytes.
23528102 GZMB polymorphism is not associated with graft rejection in kidney transplant recipients.
23440692 Single nucleotide polymorphism rs8192916 located in GZMB is associated with the progression of joint destruction in rheumatoid arthritis as well as with RNA expression in whole blood.
23407551 IL-21-induced granzyme B production by plasmacytoid dendritic cells inhibits T-cell proliferation.
23382885 We found that blockade of Kv1.3 with both lentivirus and pharmacologic agents effectively inhibited cytotoxic effector memory cells' proliferation, secretion of GrB, and their ability to kill neural progenitor cells.
23377437 This study defines the final sequence of events controlling cytotoxic lymphocyte immune defense, in which perforin pores assemble on the target cell plasma membrane, ensuring efficient delivery of lethal granzymes.
23333304 HIV-1 infected CCR5+ memory CD4+ T cells upregulate granzyme B and HIV-1 CA production and increase the ratio of granzyme B to CA compared to infected CCR5- cells
23326234 Granzyme A produced by gamma(9)delta(2) T cells induces human macrophages to inhibit growth of an intracellular pathogen.
23321921 Vitiligo is associated with 55R-94A-247H variant haplotype of GZMB.
23321919 Our results reveal a dichotomy in human CL: CD8(+) granzyme B(+)T cells mediate tissue injury, whereas CD4(+)IFN-gamma(+)T cells mediate leishmania parasite killing.
23228447 Granzyme B cleavage of fibronectin disrupts endothelial cell adhesion, migration and capillary tube formation.
23172556 Common variable immunodeficiency patients with autoimmunity have elevated levels of activated T cells expressing granzyme B and HLA-DR.
22759804 Data show that upregulation of sCD30, iATP, granzyme B, perforin, and downregulation of HLA-G5 could provide valuable diagnostic standards to identify those recipients in the risk of acute rejection (AR).
22547705 During chronic inflammation, GATA-3+ T helper (Th)2 inhibitory cells express high levels of inhibitory proteins including interleukin (IL)-10, CTLA-4, and granzyme B, but do so independently of Foxp3.
22479366 Data show that granzyme B (GrB) liberated TGF-beta1 from substrates decorin, biglycan and betaglycan.
22476618 Patients with chronic immune thrombocytopenia have elevated serum granzyme B levels.
22438997 following GzmB uptake, Plasmodium falciparum-infected erythrocytes undergo eryptosis via a perforin-independent, GzmB-mediated mechanism.
22430249 These findings identify IL-27-induced IL-21 as a key autocrine regulator of granzyme B expression in human CD8(+) T cells.
22387007 lung cancer cells utilise their increased PI-9 expression to protect from granzyme B-mediated cytotoxicity as an immune evasion mechanism
22194691 Granzyme B-induced inhibition of viral translation was independent of the activation of caspases. Eukaryotic initiation factor 4 gamma 3 is newly identified as GrB's target.
22172867 Cumulative exposure to CD8+ granzyme Bhi T cells is associated with reduced lung function early after lung transplantation.
22142046 Increased transcript levels of TNF-alpha, TGF-beta, and granzyme B in endomyocardial biopsies correlate with allograft rejection.
22089193 results suggest that cytotoxic T-lymphocytes are activated in severe sepsis and express significantly higher intracellular levels of GzmB and that GzmA and B levels correlate with disease severity.
22084442 Granzyme B-deficient mice, and to a lesser extent perforin-deficient mice, exhibit a significant increase in the number of antigen-specific CD8+ T cells in the lungs and draining lymph nodes of virally infected animals.
22050094 Perforin and granzyme B expression in oral and cutaneous lichen planus
21964027 Human neurons are selectively susceptible to serine-protease granzyme B (GrB) isolated from cytotoxic T cell granules: activated T cells from GrB knockout mice fail to kill mouse neurons.
21960590 Human microRNA (miR)-27a* is a negative regulator of NK-cell cytotoxicity by silencing Prf1 and GzmB expression.
21948366 The present data suggest a new form of interaction between the complement and the apoptosis system on the level of granzyme B that is capable to generate C3a and C5a independently of the established complement proteases.
21919028 Inhibition of Granzyme B by PI-9 protects prostate cancer cells from apoptosis.
21886827 association between the granzyme B genotype and better clinical outcomes in patients with myeloid malignancies after unrelated bone marrow transplantation
21884199 Low expression of Granzyme B was associated with early signs of metastasis in colorectal cancer.
21709155 A critical and previously unsuspected role is revealed for granzymes A and B in dictating immunogenicity by influencing the mode of tumor cell death.
21548883 cleavage of Notch1 by GrB resulted in a loss of transcriptional activity, independent of Notch1 activation. We conclude that GrB disables Notch1 function, probably resulting in anti-cellular proliferation and cell death signals.
21458778 that excessive secretion of soluble granzyme B and enhanced activity of cytotoxic T lymphocyte may play a vital role in the pathogenesis of systemic lupus erythematosus and organ damage
21349256 The results indicate that GzmA and GzmB are implicated in mechanisms of neurodegeneration in amyotrophic lateral sclerosis.
21326808 JunB is a direct transcriptional activator of GzB and that GzB transcription is also promoted by NPM-ALK.
21301799 Our data suggest that granzyme B may exert cell death through DNA damage signaling.
21203542 Maltose-binding protein enhances secretion of recombinant human granzyme B accompanied by in vivo processing of a precursor MBP fusion protein
21156847 granzyme B gene expression and therefore human NK-cell cytotoxicity can be regulated by the PP2A-SET interplay
21042704 The gene structure and expression of GrB, its biosynthesis and activation, delivery mechanisms into the target cell cytoplasm, direct proteolytic involvement in activation of several pro-apoptotic pathways, and regulation of its activity in cancer cells.
20959405 Observational study of gene-disease association. (HuGE Navigator)
20825413 These results suggest that increased leukocyte infiltration and elevated Gra-b levels in the post-stroke brain can induce contact-dependent and independent post-ischemic neuronal death to aggravate stroke injury.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20633650 elevated mRNA levels in broncho-alveolar-lavage, but not in blood, during acute rejection of lung allografts
20618609 Results showed high concentrations of granzyme B-positive cells both in the epithelium and in the whole mucosa of chronic graft vs host disease patients; however, apoptosis seems to correlate with granzyme release in oral lichen planus patients.
20536562 Review: emphasize the peculiar characteristics of GzmB that make it suited for use as an effector domain in potential immunoconjugate.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20497195 Upregulation of granzyme B is associated with acute pancreas allograft rejection.
20449762 a clathrin-dependent endocytosis stimulated by target cell occurs in NK92 cell line, which is closely correlated with granzyme B recovery.
20410501 Observational study of gene-disease association. (HuGE Navigator)
20394077 elevated serum level associated with systemic lupus erythematosus
20388708 This study is the first to demonstrate GrB activity within the mitochondrion and to identify Hax-1 cleavage as a novel mechanism for GrB-mediated mitochondrial depolarization.
20371822 Neural progenitor cell proliferation and differentiation are impaired by granzyme B release from T-cells.
20194725 granzyme B-cleaved transaldolase-specific T cell-mediated cytotoxicity may contribute to the progressive destruction of oligodendrocytes in patients with multiple sclerosis
20087581 increased granzyme B(+) cell infiltration after neoadjuvant chemotherapy displayed a tendency for improved progression-free survival in ovarian cancer patients
20038786 Perforin activates clathrin- and dynamin-dependent endocytosis, which is required for plasma membrane repair and delivery of granzyme B for granzyme-mediated apoptosis.
20035050 GZMB contributes to abdominal aortic aneurysm pathogenesis via a perforin-independent mechanism involving extracellular matrix degradation and subsequent loss of vessel wall integrity.
20027633 data provides the first evidence for a role of GrB in promoting cancer cell invasion. Taken together, our findings suggest that Granzyme B (GrB), via ECM degradation, contributes to the establishment of the urothelial carcinoma invasive phenotype
19956856 upregulated expression of PI-9 in NSCLC cells may serve to protect them from apoptosis induced by GrB
19801510 the production of GzmB by strongly activated CD4 T cells represents a mechanism by which CD4 T cells resist Treg suppression.
19796544 there is no evidence for an association of granzyme B gene polymorphism with Behcet's disease
19796544 Observational study of gene-disease association. (HuGE Navigator)
19759420 absence of GrB+ tumour-infiltrating lymphocytes in primary melanoma excisional biopsies in immunohistochemistry might be used to predict presence of sentinel lymph node metastasis.
19592644 BCR stimulation with either viral Ags or activating Abs in the context of the acute phase cytokine IL-21 can induce the secretion of substantial amounts of GrB by human B cells.
19543056 55 Q/Q genotype is associated with increased in vitro expression of granzyme B and is associated with allograft rejection in heart transplantation.
19543056 Observational study of gene-disease association. (HuGE Navigator)
19458908 Another cascade not associated with TNF-alpha may induce granzyme B and RANTES production in rheumatoid arthritis patients.
19446661 data suggest that reduction in the proportion of gammadelta T cells and granzyme B gene polymorphism leads to defective immune function in breast cancer patients
19343046 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19175398 Granzyme B level was elevated, especially in the early stage of Rasmussen syndrome disease.
19157637 increased expression of T cells following treatment with MT110,an EpCAM/CD3-bispecific antibody
19145036 Plasma levels of granzyme B increased after acute myocardial infarct, which might be an important factor in the progression of late LV remodeling after infarct
19141860 Observational study of gene-disease association. (HuGE Navigator)
19141320 difference in gene expression between acute rejection and non-rejection in kidney graft biopsies
19079360 The release of GrB through two routes from unconjugated cytotoxic lymphocytes suggests that it functions outside the cell and may contribute to pathology in cases of immune dysregulation.
18836177 In vitro protease substrate profiling of the apoptotic serine protease granzyme B was performed resulting in the delineation of more than 800 cleavage sites in 322 human and 282 mouse substrates
18814951 five genes (TNFSF10/TRAIL, IL1RN, IFI27, GZMB, and CCR5) were upregulated and three genes (CLK1, TNFAIP3 and BTG1) were downregulated in at least three out of four subpopulations during acute GVHD.
18785318 Granzyme B induces apoptosis of chondrocytes with natural killer cell-like cytotoxicity in rheumatoid arthritis
18772390 In a cell-based system GzmB-deficient natural killer cells provided perforin (pfn) by natural polarized secretion and synergized with externally added GzmB
18675462 The potential role for GrB in the process of initiation of myasthenia gravis, and are consistent with the concept of an immunodominant epsilon epitope of acetylcholine receptors.
18580471 Granzyme B and perforin are diagnostic molecular markers of acute rejection. Granzyme B and perforin blood levels are also increased in viral infections and posttransplant lymphoproliferative disease.
18568772 In cervical carcinomas, high pre-treatment GZMB level was associated with poor response to therapy.
18523274 Accessible chromatin-associated (histone 3 lysine 9) acetylation state serves as a cornerstone for differentially high expression of effector gene eomesodermin and its targets perforin 1 and granzyme B in memory CD8 T cells.
18317234 Report activation of the granzymeA/B pathway in children with severe respiratory syncytial virus infection.
18311812 The genes PRF1, GZMB, UNC13D, and Rab27a involved in hemophagocytic lymphohistiocytosis do not confer a significant risk of association with systemic-onset juvenile idiopathic arthritis.
18311812 Observational study of gene-disease association. (HuGE Navigator)
18275349 We report on a frequent ex vivo dissociation of the HIV peptide-induced secretion of perforin, granzymeB and IFN gamma by HIV-specific CD8(+) cells in HIV infection.
18024321 The ratio of FOXP3+ regulatory T-cells to granzyme B+ cytotoxic T/NK Cells predicts prognosis in classical Hodgkin lymphoma.
17996944 Granzyme B, on one hand might, enhance the cytotoxic potential of PMN, on the other, it may provide PMN with additional means to degrade extracellular matrices.
17976318 The results indicated that the high expression of NKG2A/CD94 and low expression of granzyme B may be related with the reduced activity of cord blood NK cells.
17869012 Show increased granzyme B positive cytotoxic T-lymphocytes in inflamed mucosa of patients with inflammatory bowel disease.
17825804 Ex vivo ELISPOT measurements of granzyme B permit the identification of actively ongoing CD8(+) cell responses-a notion that is pertinent to the immune diagnostic of infections, transplantation, allergies, autoimmune diseases, tumors, vaccine development.
17785818 Detection of target granzyme B activity followed by caspase 3 activation provides a unique readout of a potentially lethal injury delivered by cytotoxic lymphocytes.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17620340 Hip is a pro-survival substrate of granzyme B
17568588 Patients with high levels of circulating granzyme B had lipid-rich carotid plaques as determined by echogenicity and had more ischemic lesions on cerebral MRI
17493234 Cytotoxic molecule (CM) expression, specifically TIA1 and granzyme B, is predictive of prognosis in Hodgkin's-like anaplastic large cell lymphoma.
17485116 Granzyme B is expressed and released by human mast cells upon physiologic stimulation.
17437484 perforin and granzyme B expressing cells in lichen sclerosis were found in the dermal infiltrate and intraepidermally in close proximity to keratinocytes suggesting in situ activation of these cells
17283187 These data demonstrate that human and murine GzmB are distinct enzymes with different substrate preferences. Our observations also illustrate how subtle differences in enzyme structure can radically affect substrate selection.
17258890 TNFalpha- and FasL-stimulated acute myeloid leukemia cell lytic induction is regulated by a signalling pathway involving sequentially, radical oxygen species generation, Trx oxidation, ASK1 activation, p38MAPK stimulation and GrB induction.
17224449 granzyme B is induced by ultraviolet A rays in human keratinocytes through MIF
17202328 cleavage and release to the extracellular milieu of the GluR3B peptide may in principle increase its antigenicity
17198275 Observational study of genotype prevalence. (HuGE Navigator)
17116752 Mouse granzyme B is 30 times less cytotoxic than human granzyme B and does not require Bid for killing but regains cytotoxicity on engineering of its active site cleft. Mouse granzyme A is considerably more cytotoxic than human granzyme A.
17077322 loss of PI9 expression in tumor cells may reflect some mechanism associated with progression
17055354 Results suggest that perforin and granzyme-B gene expressions are accurate in detecting both cellular and antibody-mediated rejection.
17015688 discovery of a new inhibitor of granzyme B and a new mechanism used by Sertoli cells for immunoprotection
16952444 data revealed significantly increased number of t-cells expressing granzyme B in rKA compared to SCC, suggesting a possible role of granzynme B in KA regression
16908262 PCR analysis for Granzyme B/perforin up-regulation might play a role along with clinical criteria for detection of presymptomatic acute rejection episodes in intestinal recipients.
16794249 granzyme B is a novel mediator of allergic diseases
16611405 GrB/scFvMEL, a fusion protein composed of human granzyme B (GrB) and the single-chain antibody scFvMEL, targets melanoma gp240 antigen and exerts impressive cytotoxic effects by inducing apoptosis.
16547254 identified a novel NF-kappaB binding site, which plays a pivotal role in controlling human granzyme B gene transcription
16547231 granzyme B is released from cytolytic granules to the cytosol of CD8(+) T lymphocytes upon CD3/Receptors, Antigen, T-Cell stimulation and escapes protease inhibitor 9, thereby mediating apoptotic cell death
16524880 UV-B induces GrB and PFN expression in keratinocytes, and these cells acquire acquire a significant cytotoxicity, which is GrB and PFN dependent, toward a variety of cellular targets.
16415351 granzyme B directly attacks a major component of the cell cytoskeleton, which may contribute to the incapacitation of target cells during CTL/NK-mediated killing
16336214 Intracellular and extracellular effects of human GrB in tumor cell lines using recombinant protein expressed in the yeast Pichia pastoris.
16166746 Mice lacking funcitonal MST1R are suceptible to acute lung injury and have increased expression of granzymes in the lung, thymus and spleen
16107729 In an electrostatic "exchange-adsorption" model, cationic sites participate in binding of GrB to the cell surface, thereby promoting its uptake and eventual release into the cytoplasm
15998831 polymorphonuclear leukocytes from mice and humans lack the 3 cytotoxic effector molecules, granzyme A, gzmB, and perforin, generally associated with natural killer and cytotoxic T lymphocytes
15880044 Cytotoxic T-lymphocyte precursor frequency can be determined by the granzyme B and interferon gamma marker for determining donor-specific cytolytic activity after clinical organ transplantation.
15843372 determination of role in cell detachment in immortalized and transformed cell lines as well as normal cell lines
15818305 etiologic agent of Kawasaki Disease interferes with expression of this cytotoxic protein by CD8 T lymphocytes, prolonging inflammation in the arterial wall and leading to coronary artery aneurysm formation.
15788411 mechanism of delivery is proposed entailing electrostatic transfer of granzyme B from serglycin to cell surface proteins
15699075 Data show that granzyme B directly cleaves ROCK II, and that this causes constitutive kinase activity and bleb formation.
15673968 expression of proteinase inhibitor-9 and granzyme B mRNAs may be controlled through different pathways
15641052 Patients with disease flares were characterized by higher proportions of perforin- and/or granzyme B-positive lymphocytes with a differentiated effector phenotype (CCR7- and CD45RA+).
15569669 granzyme B targets a highly restricted range of substrates and orchestrates cellular demolition largely through activation of caspase-3
15528317 cell surface heparan sulfate-bound GzmB was taken up rapidly into intracellular lysosomal compartments; blocking treatments had no an inhibitory influence on induced apoptosis
15494398 proteinase inhibitor 9 was effectively hydrolyzed and inactivated by human granzyme M, raising the possibility that this orphan granzyme bypasses proteinase inhibitor 9 inhibition of granzyme B
15238416 results demonstrate discordant expression of granzymes A and B in human lymphocyte subsets and T regulatory cells, which suggests that different granzymes may play unique roles in immune system responses and regulation
15069086 granzyme H complements the pro-apoptotic function of granzyme B in human NK cells
15014070 Mcl-1L degradation by either GrB or caspase-3 interferes with Bim sequestration by Mcl-1L
14996347 examined the correlation between injury of the hepatocytes and mRNA expression of FasL and perforin/granzyme B in liver tissue to investigate the roles of both the FasL and the perforin/granzyme B pathways in chronic hepatitis B
14967307 expression levels of granzyme B mRNA was significantly higher in the patients undergoing acute rejection as compared to patients with stable lung function
14752093 the RAH allele represents a neutral polymorphism in the GrB gene; it retains pro-apoptotic activity
14739229 serglycin-bound granzyme B in high-molecular-weight degranulate material from cytotoxic T lymphocytes predominantly followed a dynamin-dependent pathway to kill target cells
14697980 Levels predict acute rejection in small intestine transplants.
14696402 These results suggest that the main pathway of cytotoxic T lymphocyte-mediated apoptosis in peptic ulcer formation is the perforin/granzyme pathway irrespective of H. pylori infection.
14635036 granzyme B leakage-induced cell death is an important determinant of activation-induced NK cell death.
14512315 PMNs contain perforin and granzyme B, the 2 molecules known as the cytotoxic entity of natural killer cells and of cytotoxic T lymphocytes
14499262 Granzyme B is a caspase-like serine protease that is released by cytotoxic lymphocytes to kill virus-infected and tumor cells.
12919092 Expressed in blood as a marker of kidney transplantation rejection.
12913938 GrB expression is present in normal human articular chondrocytes and elevated in rheumatoid arthritis chondrocytes
12648453 granzyme B mediates direct cleavage of caspase 3 and also activates mitochondrial disruption, resulting in the release of proapoptotic proteins that suppress caspase inhibition
12648450 granzyme B initiates caspase processing but cannot fully process procaspase-3 in intact Jurkat T leukemia or NT2 neuronal cells
12645627 Results suggest that cell-mediated cytotoxicity during HIV-1 infection may be impaired due to a deficient quantity of active granule proteins such as granzyme B or to their abnormal regulation.
12483306 Sequence analysis of this gene do not support it as a candidate gene for familial hemophagocytic lymphohistiocytosis.
12388539 proapoptotic granzyme is exocytosed predominantly as a macromolecular complex with serglycin
12384430 expression of granzyme B in plasmacytoid dendritic cells
12200377 most WT1- and proteinase 3-reactive CD8 T-cells observed in patients with acute myeloid leukemia were granzyme B(+).
12135665 A comparison of proforms and mature forms of granzyme B in regulating granulopoiesis
12009596 expressed during acute cellular rejection episodes after kidney transplantation

AA Sequence

MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSI      1 - 70
NVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQ     71 - 140
TCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCN    141 - 210
KVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY                                     211 - 247
//

Text Mined References (252)

PMID Year Title
27117663 2016 Apoptosis Markers in Breast Cancer Therapy.
26927382 2016 [Rapid biosynthesis and release of 35 kD granzyme B by NK92 cells bypassing secretory lysosomes].
26830472 2016 Epitelial-to-mesenchimal transition and invasion are upmodulated by tumor-expressed granzyme B and inhibited by docosahexaenoic acid in human colorectal cancer cells.
26752517 2016 Killer lymphocytes use granulysin, perforin and granzymes to kill intracellular parasites.
26670609 2016 A Novel Serpin Regulatory Mechanism: SerpinB9 IS REVERSIBLY INHIBITED BY VICINAL DISULFIDE BOND FORMATION IN THE REACTIVE CENTER LOOP.
26633185 Serum levels of granzyme B decrease in patients with rheumatoid arthritis responding to abatacept.
26610869 2016 Granzyme B Deficiency Protects against Angiotensin II-Induced Cardiac Fibrosis.
26410968 2015 Evaluation of the Role of Granzyme B in Exuberant Scar Pathogenesis: An Immunohistochemical Study.
26314831 2016 Selective Loss of Signaling Lymphocytic Activation Molecule Family Member 4-Positive CD8+ T Cells Contributes to the Decreased Cytotoxic Cell Activity in Systemic Lupus Erythematosus.
26207425 2015 Brief Exercises Affect Gene Expression in Circulating Monocytes.
26156785 2015 Increased intra- and extracellular granzyme expression in patients with tuberculosis.
25780036 2015 CD4+ T cell-derived IL-21 and deprivation of CD40 signaling favor the in vivo development of granzyme B-expressing regulatory B cells in HIV patients.
25745046 2015 Increased expression of granzymes A and B in fatal asthma.
25725937 2015 Increased expression of perforin, granzyme B, and C5b-9 in villitis of unknown etiology.
25671296 2015 Active secretion of CXCL10 and CCL5 from colorectal cancer microenvironments associates with GranzymeB+ CD8+ T-cell infiltration.
25667415 2015 Granzyme B expression is enhanced in human monocytes by TLR8 agonists and contributes to antibody-dependent cellular cytotoxicity.
25643139 2015 A Meta-analysis of the Significance of Granzyme B and Perforin in Noninvasive Diagnosis of Acute Rejection After Kidney Transplantation.
25637022 2015 Nonapoptotic and extracellular activity of granzyme B mediates resistance to regulatory T cell (Treg) suppression by HLA-DR-CD25hiCD127lo Tregs in multiple sclerosis and in response to IL-6.
25531694 2015 Synthetic consensus HIV-1 DNA induces potent cellular immune responses and synthesis of granzyme B, perforin in HIV infected individuals.
25404359 2015 Granzyme B-activated p53 interacts with Bcl-2 to promote cytotoxic lymphocyte-mediated apoptosis.
25367116 2014 Polarized granzyme release is required for antigen-driven transendothelial migration of human effector memory CD4 T cells.
25361078 2015 Granzyme B-induced mitochondrial ROS are required for apoptosis.
25313744 Granzyme B gene polymorphisms, colorectal cancer risk, and metastasis.
25245659 2014 Granzyme B secretion by human memory CD4 T cells is less strictly regulated compared to memory CD8 T cells.
25159843 2014 Cytohesin-associated scaffolding protein (CASP) is a substrate for granzyme B and ubiquitination.
25146929 2015 Perforin oligomers form arcs in cellular membranes: a locus for intracellular delivery of granzymes.
24999042 2014 HIV replication in conjunction with granzyme B production by CCR5+ memory CD4 T cells: Implications for bystander cell and tissue pathologies.
24894428 2014 Lung cancer is associated with decreased expression of perforin, granzyme B and interferon (IFN)-? by infiltrating lung tissue T cells, natural killer (NK)?T-like and NK cells.
24875585 2014 Granzyme B gene polymorphism associated with subacute sclerosing panencephalitis.
24835396 2014 Plasma cells in the mucosa of patients with inflammatory bowel disease produce granzyme B and possess cytotoxic activities.
24696715 2014 Co-expression of perforin and granzyme B genes induces apoptosis and inhibits the tumorigenicity of laryngeal cancer cell line Hep-2.
24673566 2014 Cytotoxic reaction mediators: granzymes A and B in women with ovarian cancer.
24488096 2014 The granzyme B-Serpinb9 axis controls the fate of lymphocytes after lysosomal stress.
24355225 Decreased expression of protease inhibitor 9, a granzyme B inhibitor, in celiac disease: a potential mechanism in enterocyte destruction and villous atrophy.
24307760 2013 Plasma granzyme B in ST elevation myocardial infarction versus non-ST elevation acute coronary syndrome: comparisons with IL-18 and fractalkine.
24195710 2014 The serine protease granzyme B as an inflammatory marker, in relation to the insulin receptor cleavage in human obesity and type 2 diabetes mellitus.
24114594 2014 Human plasma cells express granzyme B.
24113190 2013 Rapid reuptake of granzyme B leads to emperitosis: an apoptotic cell-in-cell death of immune killer cells inside tumor cells.
24101526 2013 Granzyme B degradation by autophagy decreases tumor cell susceptibility to natural killer-mediated lysis under hypoxia.
23980805 2013 Immunohistochemical expression of granzyme B and perforin in discoid lupus erythematosus.
23892923 2013 Suppression of granzyme B activity and caspase-3 activation in leukaemia cells constitutively expressing the protease inhibitor 9.
23820889 2014 CD8+ T cell granzyme B activates keratinocyte endogenous IL-18.
23607435 2013 Association of human cytomegalovirus DNAaemia and specific granzyme B responses in lung transplant recipients.
23598339 2013 Gating of the TrkH ion channel by its associated RCK protein TrkA.
23555267 2013 Hantavirus-infection confers resistance to cytotoxic lymphocyte-mediated apoptosis.
23528102 Association between granzyme B and perforin I polymorphisms and allograft outcomes in Hispanic kidney transplant recipients.
23440692 2013 A genetic variant in granzyme B is associated with progression of joint destruction in rheumatoid arthritis.
23407551 2013 IL-21-stimulated human plasmacytoid dendritic cells secrete granzyme B, which impairs their capacity to induce T-cell proliferation.
23382885 2013 Blockade of Kv1.3 potassium channels inhibits differentiation and granzyme B secretion of human CD8+ T effector memory lymphocytes.
23377437 2013 Perforin forms transient pores on the target cell plasma membrane to facilitate rapid access of granzymes during killer cell attack.
23326234 2013 Granzyme A produced by ?(9)?(2) T cells induces human macrophages to inhibit growth of an intracellular pathogen.
23321921 2013 Risk of generalized vitiligo is associated with the common 55R-94A-247H variant haplotype of GZMB (encoding granzyme B).
23321919 2013 CD8(+) granzyme B(+)-mediated tissue injury vs. CD4(+)IFN?(+)-mediated parasite killing in human cutaneous leishmaniasis.
23228447 2013 Granzyme B cleavage of fibronectin disrupts endothelial cell adhesion, migration and capillary tube formation.
23172556 2013 CVID patients with autoimmunity have elevated T cell expression of granzyme B and HLA-DR and reduced levels of Treg cells.
23099058 2012 Granzyme B in injury, inflammation, and repair.
22759804 2012 Assessment of different biomarkers provides valuable diagnostic standards in the evaluation of the risk of acute rejection.
22547705 2012 IL-10+ CTLA-4+ Th2 inhibitory cells form in a Foxp3-independent, IL-2-dependent manner from Th2 effectors during chronic inflammation.
22479366 2012 Granzyme B cleaves decorin, biglycan and soluble betaglycan, releasing active transforming growth factor-?1.
22476618 2012 Increased plasma levels of granzymes in adult patients with chronic immune thrombocytopenia.
22438997 2012 Plasmodium falciparum-infected erythrocytes induce granzyme B by NK cells through expression of host-Hsp70.
22430249 2012 IL-27 induction of IL-21 from human CD8+ T cells induces granzyme B in an autocrine manner.
22387007 2012 Increased proteinase inhibitor-9 (PI-9) and reduced granzyme B in lung cancer: mechanism for immune evasion?
22194691 2011 Granzyme B inhibits vaccinia virus production through proteolytic cleavage of eukaryotic initiation factor 4 gamma 3.
22172867 2011 Cumulative exposure to CD8+ granzyme Bhi T cells is associated with reduced lung function early after lung transplantation.
22142046 2011 Increased transcript levels of TNF-alpha, TGF-beta, and granzyme B in endomyocardial biopsies correlate with allograft rejection.
22089193 2012 Increased granzyme levels in cytotoxic T lymphocytes are associated with disease severity in emergency department patients with severe sepsis.
22084442 2011 Granzyme B regulates antiviral CD8+ T cell responses.
22050094 2011 Perforin and granzyme B expression in oral and cutaneous lichen planus - a comparative study.
21964027 2011 Granule-derived granzyme B mediates the vulnerability of human neurons to T cell-induced neurotoxicity.
21960590 2011 Human microRNA-27a* targets Prf1 and GzmB expression to regulate NK-cell cytotoxicity.
21948366 2012 Granzyme B: a new crossroad of complement and apoptosis.
21919028 2012 Inhibition of Granzyme B by PI-9 protects prostate cancer cells from apoptosis.
21886827 2011 Genetic variants of human granzyme B predict transplant outcomes after HLA matched unrelated bone marrow transplantation for myeloid malignancies.
21884199 2011 Low expression of Granzyme B in colorectal cancer is associated with signs of early metastastic invasion.
21795594 2011 The novel role of SERPINB9 in cytotoxic protection of human mesenchymal stem cells.
21709155 2011 A critical role for granzymes in antigen cross-presentation through regulating phagocytosis of killed tumor cells.
21548883 2011 Cleavage of Notch1 by granzyme B disables its transcriptional activity.
21458778 2011 Soluble granzyme B and cytotoxic T lymphocyte activity in the pathogenesis of systemic lupus erythematosus.
21349256 2011 Granzymes A and B levels in serum of patients with amyotrophic lateral sclerosis.
21326808 2011 NPM-ALK and the JunB transcription factor regulate the expression of cytotoxic molecules in ALK-positive, anaplastic large cell lymphoma.
21301799 2011 hSMG-1 is a granzyme B-associated stress-responsive protein kinase.
21203542 2010 Maltose-binding protein enhances secretion of recombinant human granzyme B accompanied by in vivo processing of a precursor MBP fusion protein.
21156847 2011 The PP2A inhibitor SET regulates granzyme B expression in human natural killer cells.
21042704 2010 Granzyme B-induced apoptosis in cancer cells and its regulation (review).
20959405 2010 The IFNG (IFN-gamma) genotype predicts cytogenetic and molecular response to imatinib therapy in chronic myeloid leukemia.
20825413 2011 Role of cytotoxic protease granzyme-b in neuronal degeneration during human stroke.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20633650 2010 Elevated mRNA levels of CTLA-4, FoxP3, and granzyme B in BAL, but not in blood, during acute rejection of lung allografts.
20618609 2010 Perforin and granzyme B involvement in oral lesions of lichen planus and chronic GVHD.
20536562 2010 Delivery and therapeutic potential of human granzyme B.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20497195 Serial analysis of biomarkers of acute pancreas allograft rejection.
20449762 2010 Granzyme B is recovered by natural killer cells via clathrin-dependent endocytosis.
20410501 2010 Variant of TYR and autoimmunity susceptibility loci in generalized vitiligo.
20394077 2010 CD5+ B cells from individuals with systemic lupus erythematosus express granzyme B.
20388708 2010 Deregulation of mitochondrial membrane potential by mitochondrial insertion of granzyme B and direct Hax-1 cleavage.
20371822 2010 Activated T-cells inhibit neurogenesis by releasing granzyme B: rescue by Kv1.3 blockers.
20194725 2010 Cleavage of transaldolase by granzyme B causes the loss of enzymatic activity with retention of antigenicity for multiple sclerosis patients.
20087581 2010 Foxp3(+) cell infiltration and granzyme B(+)/Foxp3(+) cell ratio are associated with outcome in neoadjuvant chemotherapy-treated ovarian carcinoma.
20038786 2010 Perforin activates clathrin- and dynamin-dependent endocytosis, which is required for plasma membrane repair and delivery of granzyme B for granzyme-mediated apoptosis.
20035050 2010 Perforin-independent extracellular granzyme B activity contributes to abdominal aortic aneurysm.
20027633 2010 Granzyme B is expressed in urothelial carcinoma and promotes cancer cell invasion.
19956856 2010 Expression of proteinase inhibitor-9/serpinB9 in non-small cell lung carcinoma cells and tissues.
19946888 2010 Defining the membrane proteome of NK cells.
19801510 2009 Cutting Edge: Responder T cells regulate human DR+ effector regulatory T cell activity via granzyme B.
19796544 No association of granzyme B gene polymorphism with Behçet's disease.
19759420 2009 Absence of Granzyme B positive tumour-infiltrating lymphocytes in primary melanoma excisional biopsies is strongly associated with the presence of sentinel lymph node metastasis.
19592644 2009 Human B cells secrete granzyme B when recognizing viral antigens in the context of the acute phase cytokine IL-21.
19543056 2009 Genotypic variation and phenotypic characterization of granzyme B gene polymorphisms.
19458908 2009 Etanercept reduces the serum levels of macrophage chemotactic protein-1 in patients with rheumatoid arthritis.
19446661 2009 Defective gammadelta T-cell function and granzyme B gene polymorphism in a cohort of newly diagnosed breast cancer patients.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19175398 2009 A substantial number of Rasmussen syndrome patients have increased IgG, CD4+ T cells, TNFalpha, and Granzyme B in CSF.
19157637 2009 Mode of cytotoxic action of T cell-engaging BiTE antibody MT110.
19145036 2009 Elevation of plasma granzyme B levels after acute myocardial infarction.
19141860 2009 Genetic variants in the candidate genes of the apoptosis pathway and susceptibility to chronic myeloid leukemia.
19141320 2009 Intragraft mRNA cytotoxic molecule expression in renal allograft recipients.
19079360 Active and zymogen forms of granzyme B are constitutively released from cytotoxic lymphocytes in the absence of target cell engagement.
18836177 2009 Analysis of protein processing by N-terminal proteomics reveals novel species-specific substrate determinants of granzyme B orthologs.
18814951 2008 Gene-expression profiles of peripheral blood mononuclear cell subpopulations in acute graft-vs-host disease following cord blood transplantation.
18785318 2008 Granzyme B induces apoptosis of chondrocytes with natural killer cell-like cytotoxicity in rheumatoid arthritis.
18772390 2008 Granzyme B delivery via perforin is restricted by size, but not by heparan sulfate-dependent endocytosis.
18675462 2008 Granzyme B: evidence for a role in the origin of myasthenia gravis.
18580471 2008 Blood monitoring of granzyme B and perforin expression after intestinal transplantation: considerations on clinical relevance.
18568772 2008 High levels of granzyme B expression in invasive cervical carcinoma correlates to poor response to treatment.
18523274 2008 Histone acetylation facilitates rapid and robust memory CD8 T cell response through differential expression of effector molecules (eomesodermin and its targets: perforin and granzyme B).
18317234 2008 Activation of the granzyme pathway in children with severe respiratory syncytial virus infection.
18311812 2008 Genetic loci contributing to hemophagocytic lymphohistiocytosis do not confer susceptibility to systemic-onset juvenile idiopathic arthritis.
18275349 2008 Dissociated production of perforin, granzyme B, and IFN-gamma by HIV-specific CD8(+) cells in HIV infection.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18024321 2007 The ratio of FOXP3+ regulatory T cells to granzyme B+ cytotoxic T/NK cells predicts prognosis in classical Hodgkin lymphoma and is independent of bcl-2 and MAL expression.
17996944 2008 Expression of granzyme B in peripheral blood polymorphonuclear neutrophils (PMN), myeloid cell lines and in PMN derived from haemotopoietic stem cells in vitro.
17976318 2007 High expression of NKG2A/CD94 and low expression of granzyme B are associated with reduced cord blood NK cell activity.
17869012 2007 Contribution of TIA-1+ and granzyme B+ cytotoxic T lymphocytes to cryptal apoptosis and ulceration in active inflammatory bowel disease.
17825804 2007 Granzyme B production distinguishes recently activated CD8(+) memory cells from resting memory cells.
17785818 2007 Granzyme B activity in target cells detects attack by cytotoxic lymphocytes.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17620340 2007 Hip is a pro-survival substrate of granzyme B.
17568588 2007 Plasma levels of granzyme B are increased in patients with lipid-rich carotid plaques as determined by echogenicity.
17493234 2007 Cytotoxic molecule expression is predictive of prognosis in Hodgkin's-like anaplastic large cell lymphoma.
17485116 2007 Human mast cells produce and release the cytotoxic lymphocyte associated protease granzyme B upon activation.
17437484 2007 Detection of perforin and granzyme B mRNA expressing cells in lichen sclerosus.
17283187 2007 Human and murine granzyme B exhibit divergent substrate preferences.
17258890 2007 Granzyme B induction signalling pathway in acute myeloid leukemia cell lines stimulated by tumor necrosis factor alpha and Fas ligand.
17224449 2007 UVA induces granzyme B in human keratinocytes through MIF: implication in extracellular matrix remodeling.
17202328 2007 TCR activation eliminates glutamate receptor GluR3 from the cell surface of normal human T cells, via an autocrine/paracrine granzyme B-mediated proteolytic cleavage.
17198275 2006 Disparate distribution of 16 candidate single nucleotide polymorphisms among racial and ethnic groups of pediatric heart transplant patients.
17116752 2006 The major human and mouse granzymes are structurally and functionally divergent.
17077322 2007 Expression of the granzyme B inhibitor PI9 predicts outcome in nasal NK/T-cell lymphoma: results of a Western series of 48 patients treated with first-line polychemotherapy within the Groupe d'Etude des Lymphomes de l'Adulte (GELA) trials.
17055354 2006 Noninvasive diagnosis of cellular and antibody-mediated rejection by perforin and granzyme B in renal allografts.
17015688 2006 Identification of a novel human granzyme B inhibitor secreted by cultured sertoli cells.
16952444 2006 A comparative study of granzyme B expression in keratoacanthoma and squamous cell carcinoma.
16908262 Two years' experience of acute rejection monitoring of intestinal transplant recipients by real-time PCR assessment of granzyme B and perforin up-regulation: considerations on diagnostic accuracy.
16794249 2006 Granzyme B, a novel mediator of allergic inflammation: its induction and release in blood basophils and human asthma.
16611405 2006 Targeted apoptosis activation with GrB/scFvMEL modulates melanoma growth, metastatic spread, chemosensitivity, and radiosensitivity.
16547254 2006 A novel NF-kappaB binding site controls human granzyme B gene transcription.
16547231 2006 Apoptotic death concurrent with CD3 stimulation in primary human CD8+ T lymphocytes: a role for endogenous granzyme B.
16524880 2006 Human keratinocytes acquire cellular cytotoxicity under UV-B irradiation. Implication of granzyme B and perforin.
16415351 2006 The cytotoxic lymphocyte protease, granzyme B, targets the cytoskeleton and perturbs microtubule polymerization dynamics.
16336214 2006 Cell binding, internalization and cytotoxic activity of human granzyme B expressed in the yeast Pichia pastoris.
16267761 2005 The granzyme B inhibitor SERPINB9 (protease inhibitor 9) circulates in blood and increases on primary cytomegalovirus infection after renal transplantation.
16166746 2006 Gene expression profiles of Mst1r-deficient mice during nickel-induced acute lung injury.
16107729 2005 Cationic sites on granzyme B contribute to cytotoxicity by promoting its uptake into target cells.
15998831 2005 Quiescent and activated mouse granulocytes do not express granzyme A and B or perforin: similarities or differences with human polymorphonuclear leukocytes?
15880044 2005 The granzyme B and interferon-gamma enzyme-linked immunospot assay as alternatives for cytotoxic T-lymphocyte precursor frequency after renal transplantation.
15843372 2005 Extracellular matrix remodeling by human granzyme B via cleavage of vitronectin, fibronectin, and laminin.
15818305 2005 CD8 T lymphocytes do not express cytotoxic proteins in coronary artery aneurysms in acute Kawasaki disease.
15788411 2005 A novel mechanism for protein delivery: granzyme B undergoes electrostatic exchange from serglycin to target cells.
15699075 2005 Direct cleavage of ROCK II by granzyme B induces target cell membrane blebbing in a caspase-independent manner.
15673968 2005 Differential expression of proteinase inhibitor-9 and granzyme B mRNAs in activated immunocompetent cells.
15641052 2005 Increase in activated CD8+ T lymphocytes expressing perforin and granzyme B correlates with disease activity in patients with systemic lupus erythematosus.
15569669 2005 Molecular ordering of the caspase activation cascade initiated by the cytotoxic T lymphocyte/natural killer (CTL/NK) protease granzyme B.
15528317 2005 Membrane receptors are not required to deliver granzyme B during killer cell attack.
15494398 2004 Granzyme M is a regulatory protease that inactivates proteinase inhibitor 9, an endogenous inhibitor of granzyme B.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15238416 2004 Differential expression of granzymes A and B in human cytotoxic lymphocyte subsets and T regulatory cells.
15069086 2004 Discordant regulation of granzyme H and granzyme B expression in human lymphocytes.
15014070 2004 Degradation of Mcl-1 by granzyme B: implications for Bim-mediated mitochondrial apoptotic events.
14996347 2004 Expression of FasL and perforin/granzyme B mRNA in chronic hepatitis B virus infection.
14967307 2004 Correlation between interleukin-15 and granzyme B expression and acute lung allograft rejection.
14752093 2004 Granzyme B encoded by the commonly occurring human RAH allele retains pro-apoptotic activity.
14739229 2004 The granzyme B-serglycin complex from cytotoxic granules requires dynamin for endocytosis.
14697980 2003 Granzyme B and perforin as predictive markers for acute rejection in human intestinal transplantation.
14696402 Perforin and granzyme B of cytotoxic T lymphocyte mediate apoptosis irrespective of Helicobacter pylori infection: possible act as a trigger of peptic ulcer formation.
14635036 2003 Granzyme B leakage-induced cell death: a new type of activation-induced natural killer cell death.
14512315 2004 Granzyme B and perforin: constitutive expression in human polymorphonuclear neutrophils.
14499262 2003 Granzyme B: pro-apoptotic, antiviral and antitumor functions.
12919092 2003 Serial peripheral blood perforin and granzyme B gene expression measurements for prediction of acute rejection in kidney graft recipients.
12913938 2003 Expression of granzyme B in human articular chondrocytes.
12721789 2003 Catalog of 680 variations among eight cytochrome p450 ( CYP) genes, nine esterase genes, and two other genes in the Japanese population.
12648453 2003 Granzyme B-induced apoptosis requires both direct caspase activation and relief of caspase inhibition.
12648450 2003 Caspase activation by granzyme B is indirect, and caspase autoprocessing requires the release of proapoptotic mitochondrial factors.
12645627 2003 Expression of granzyme B mRNA is altered in human immunodeficiency virus infected patients.
12524539 2003 Cleaving the oxidative repair protein Ape1 enhances cell death mediated by granzyme A.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12483306 2003 Sequence analysis of the granulysin and granzyme B genes in familial hemophagocytic lymphohistiocytosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388539 2002 Cytotoxic cell granule-mediated apoptosis. Characterization of the macromolecular complex of granzyme B with serglycin.
12384430 2002 Subtractive hybridization reveals the expression of immunoglobulin-like transcript 7, Eph-B1, granzyme B, and 3 novel transcripts in human plasmacytoid dendritic cells.
12218164 2002 Identification of human autoantibodies to the DNA ligase IV/XRCC4 complex and mapping of an autoimmune epitope to a potential regulatory region.
12200377 2002 CD8 T-cell responses to Wilms tumor gene product WT1 and proteinase 3 in patients with acute myeloid leukemia.
12135665 2002 Functional dissociation between proforms and mature forms of proteinase 3, azurocidin, and granzyme B in regulation of granulopoiesis.
12009596 2002 Granzyme B, FAS-ligand and perforin expression during acute cellular rejection episodes after kidney transplantation: comparison between blood and renal aspirates.
11911826 2002 Cytotoxic cell granule-mediated apoptosis: perforin delivers granzyme B-serglycin complexes into target cells without plasma membrane pore formation.
11909973 2002 HMG2 interacts with the nucleosome assembly protein SET and is a target of the cytotoxic T-lymphocyte protease granzyme A.
11802788 2002 The human homologue of the yeast polyubiquitination factor Ufd2p is cleaved by caspase 6 and granzyme B during apoptosis.
11665980 2001 Novel fragments of the Sjögren's syndrome autoantigens alpha-fodrin and type 3 muscarinic acetylcholine receptor generated during cytotoxic lymphocyte granule-induced cell death.
11406587 2001 Direct cleavage of the human DNA fragmentation factor-45 by granzyme B induces caspase-activated DNase release and DNA fragmentation.
11331782 2001 Granzymes A and B directly cleave lamins and disrupt the nuclear lamina during granule-mediated cytolysis.
11325591 2001 The three-dimensional structure of human granzyme B compared to caspase-3, key mediators of cell death with cleavage specificity for aspartic acid in P1.
11266473 2001 Defective granule exocytosis in Rab27a-deficient lymphocytes from Ashen mice.
11209755 2000 Crystal structure of the caspase activator human granzyme B, a proteinase highly specific for an Asp-P1 residue.
11160179 2001 Granzyme B proteolysis of a neuronal glutamate receptor generates an autoantigen and is modulated by glycosylation.
11114298 2001 Granzyme B induces BID-mediated cytochrome c release and mitochondrial permeability transition.
11085743 2000 Initiation of apoptosis by granzyme B requires direct cleavage of bid, but not direct granzyme B-mediated caspase activation.
11081635 2000 Mannose 6-phosphate/insulin-like growth factor II receptor is a death receptor for granzyme B during cytotoxic T cell-induced apoptosis.
11050075 2000 Filamin (280-kDa actin-binding protein) is a caspase substrate and is also cleaved directly by the cytotoxic T lymphocyte protease granzyme B during apoptosis.
10228010 1999 Apoptosis induced by granzyme B-glycosaminoglycan complexes: implications for granule-mediated apoptosis in vivo.
9852092 1998 Granzyme B mimics apical caspases. Description of a unified pathway for trans-activation of executioner caspase-3 and -7.
9727491 1998 Bid, a Bcl2 interacting protein, mediates cytochrome c release from mitochondria in response to activation of cell surface death receptors.
9694885 1998 Cytotoxic T lymphocyte-assisted suicide. Caspase 3 activation is primarily the result of the direct action of granzyme B.
9651578 1998 Autoactivation of procaspase-9 by Apaf-1-mediated oligomerization.
9642276 1998 Caspases cleave focal adhesion kinase during apoptosis to generate a FRNK-like polypeptide.
9586635 1998 Granzyme B directly and efficiently cleaves several downstream caspase substrates: implications for CTL-induced apoptosis.
9464839 1997 Cleavage of FLICE (caspase-8) by granzyme B during cytotoxic T lymphocyte-induced apoptosis.
9337844 1997 Caspases: the executioners of apoptosis.
9233763 1997 Involvement of caspase-4(-like) protease in Fas-mediated apoptotic pathway.
8910377 1996 A cytosolic granzyme B inhibitor related to the viral apoptotic regulator cytokine response modifier A is present in cytotoxic lymphocytes.
8900201 1996 The Ced-3/interleukin 1beta converting enzyme-like homolog Mch6 and the lamin-cleaving enzyme Mch2alpha are substrates for the apoptotic mediator CPP32.
8770355 1995 Target cell apoptosis induced by cytotoxic T cells and natural killer cells involves synergy between the pore-forming protein, perforin, and the serine protease, granzyme B.
8631895 1996 Processing and activation of CMH-1 by granzyme B.
8258716 1993 Human granzyme B degrades aggrecan proteoglycan in matrix synthesized by chondrocytes.
8156655 1994 Hypothesis: cytotoxic lymphocyte granule serine proteases activate target cell endonucleases to trigger apoptosis.
3263427 1988 Characterization of granzymes A and B isolated from granules of cloned human cytotoxic T lymphocytes.
3262682 1988 Characterization of three serine esterases isolated from human IL-2 activated killer cells.
3261871 1988 Molecular cloning of an inducible serine esterase gene from human cytotoxic lymphocytes.
3258865 1988 Structure and differential mechanisms of regulation of expression of a serine esterase gene in activated human T lymphocytes.
2953813 1987 Induction of mRNA for a serine protease and a beta-thromboglobulin-like protein in mitogen-stimulated human leukocytes.
2788607 1989 Genomic organization and chromosomal assignment for a serine protease gene (CSPB) expressed by human cytotoxic lymphocytes.
2402757 1990 Characterization of a novel, human cytotoxic lymphocyte-specific serine protease cDNA clone (CSP-C).
2365998 1990 Nucleotide sequence and genomic organization of a human T lymphocyte serine protease gene.
2332171 1990 Structural organization of the hCTLA-1 gene encoding human granzyme B.
2323780 1990 Isolation of a cDNA clone encoding a novel form of granzyme B from human NK cells and mapping to chromosome 14.
2300587 1990 A cluster of hematopoietic serine protease genes is found on the same chromosomal band as the human alpha/delta T-cell receptor locus.
2193684 1990 Cloning of a gene that encodes a new member of the human cytotoxic cell protease family.
2049336 1991 Structure and evolutionary origin of the human granzyme H gene.
1985927 1991 Human cytotoxic lymphocyte granzyme B. Its purification from granules and the characterization of substrate and inhibitor specificity.
1067155 1976 Reproducibility of response to a questionnaire on symptoms of masticatory dysfunction.