Property Summary

NCBI Gene PubMed Count 17
PubMed Score 34.74
PubTator Score 15.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Glycogen storage disease 37 4.085 2.0
Disease Target Count Z-score Confidence
Hypoglycemia 81 3.272 1.6
Disease Target Count
Glycogen Storage Disease 0, Liver 1
Disease Target Count
Glycogen storage disease 0 1

Expression

  Differential Expression (3)

Disease log2 FC p
esophageal adenocarcinoma -1.700 2.8e-02
pancreatic ductal adenocarcinoma liver m... -2.822 2.5e-02
psoriasis -1.600 1.5e-06

Protein-protein Interaction (3)

Gene RIF (8)

PMID Text
23426827 Sequencing of the GYS2 gene is more likely to be positive in patients with fasting ketotic hypoglycaemia and concomitant postprandial hyperglycaemia with hyperlactataemia.
22951595 The GYS2 gene is a new susceptibility gene that significantly affects the risk for ovary syndrome through obesity-related conditions.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20691427 Observational study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12732844 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MLRGRSLSVTSLGGLPQWEVEELPVEELLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWGENYFLIGPYF      1 - 70
EHNMKTQVEQCEPVNDAVRRAVDAMNKHGCQVHFGRWLIEGSPYVVLFDIGYSAWNLDRWKGDLWEACSV     71 - 140
GIPYHDREANDMLIFGSLTAWFLKEVTDHADGKYVVAQFHEWQAGIGLILSRARKLPIATIFTTHATLLG    141 - 210
RYLCAANIDFYNHLDKFNIDKEAGERQIYHRYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPN    211 - 280
GLNVKKFSAVHEFQNLHAMYKARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLN    281 - 350
FLLRMHKSDITVMVFFIMPAKTNNFNVETLKGQAVRKQLWDVAHSVKEKFGKKLYDALLRGEIPDLNDIL    351 - 420
DRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRTDRVKVILHPEFLSSTSPLLP    421 - 490
MDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQEHVADPTAYGIYIVDRRFRSP    491 - 560
DDSCNQLTKFLYGFCKQSRRQRIIQRNRTERLSDLLDWRYLGRYYQHARHLTLSRAFPDKFHVELTSPPT    561 - 630
TEGFKYPRPSSVPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGE    631 - 700
YKN                                                                       701 - 703
//

Text Mined References (19)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23426827 2012 Mutational analysis of the GYS2 gene in patients diagnosed with ketotic hypoglycaemia.
22951595 2012 Genome-wide association study identifies GYS2 as a novel genetic factor for polycystic ovary syndrome through obesity-related condition.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20691427 2010 Genetic associations of brain structural networks in schizophrenia: a preliminary study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12732844 2003 A study to survey susceptible genetic factors responsible for troglitazone-associated hepatotoxicity in Japanese patients with type 2 diabetes mellitus.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
9691087 1998 Mutations in the liver glycogen synthase gene in children with hypoglycemia due to glycogen storage disease type 0.
8203908 1994 Primary structure of human liver glycogen synthase deduced by cDNA cloning.
8188280 1994 The human liver Glycogen synthase isozyme gene is located on the short arm of chromosome 12.
2169698 1990 Short-term hormonal control of protein phosphatases involved in hepatic glycogen metabolism.
1731614 1992 Comparative characterization of human and rat liver glycogen synthase.