Property Summary

NCBI Gene PubMed Count 59
PubMed Score 150.62
PubTator Score 60.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 1.300 6.7e-04
osteosarcoma -1.123 7.1e-04
astrocytoma 1.200 4.8e-02
atypical teratoid / rhabdoid tumor 1.300 1.2e-06
glioblastoma 1.200 1.3e-03
non-small cell lung cancer 1.077 1.7e-17
posterior fossa group A ependymoma 1.200 2.4e-06
ovarian cancer 1.100 5.5e-05

Protein-protein Interaction (3)

Gene RIF (32)

PMID Text
25703587 High glycogen synthase 1 expression is associated with myeloid leukemia.
25487600 Overexpression of GYS1, MIF, and MYC is associated with adverse outcome and poor response to azacitidine in myelodysplastic syndromes and acute myeloid leukemia
25371328 over-expression of muscle glycogen synthase (MGS)was detected in diabetic human kidney
23321478 Data suggest that although COOH-terminal dephosphorylation is likely necessary for GS activation, protein kinase Akt-2- (Akt2)-dependent NH2-terminal dephosphorylation is site for "fine-tuning" insulin-mediated GS activation in skeletal muscle.
23134486 Allosteric regulation and the relationship between phosphorylation and the kinetics of glycogen synthase. [Review]
22403297 The present findings demonstrate that physical inactivity-induced insulin resistance in muscle is associated with lower content/activity of key proteins in glucose transport/phosphorylation and storage.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20384434 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20300197 GYS1 regulation by HIF plays a central role in the hypoxic accumulation of glycogen, and hypoxia also upregulates the expression of UTP:glucose-1-phosphate urydylyltransferase (UGP2) and 1,4-alpha glucan branching enzyme (GBE1)
20017397 The regulation of glucose-6-phosphate dehydrogenase and glycogen synthase activities by insulin superfamily peptides in myometrium of pregnant women and its impairments under different types of diabetes mellitus
19913121 Observational study of gene-disease association. (HuGE Navigator)
19837931 Dysregulation of glycogen synthase phosphorylation plays a major role in impaired insulin regulation of GS in obesity and type 2 diabetes mellitus.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19420105 Observational study of gene-disease association. (HuGE Navigator)
19339242 After overnight low muscle glycogen level and/or in response to exhausting exercise-induced glycogenolysis, GSY is associated with spherical structures at the I-band of sarcomeres.
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18544618 Pioglitazone treatment improved insulin-stimulated glucose metabolism and glycogen synthase activity in PCOS.
17928598 3 siblings were identified with profound muscle glycogen deficiency and homozygous stop mutations in GYS1
17356695 Exercise unmaskd the effect associated with the GYS1 polymorphism, rendering carriers of this allele less susceptible to the protective effect of exercise on the risk of cardiovascular mortality.
17356695 Observational study of gene-disease association. (HuGE Navigator)
17137217 Observational study of gene-disease association. (HuGE Navigator)
15955076 no nuclear export signal was identified in the sequence of the protein, the region comprising amino acids 555-633, which has an Arg-rich cluster involved in the allosteric activation is crucial for its nuclear concentration and aggregation.
15855312 Phosphorylation at site 2 in the elderly and at site 3a + 3b in young twins had a genetic component.
15194499 Data show that myotubes defective in glycogen synthase (GS) activity express insulin-responsive glycogen synthase kinase-3alpha, suggesting that failure of insulin to decrease GS phosphorylation involves abnormal activity of another kinase or phosphatase.
12870167 Observational study of gene-disease association. (HuGE Navigator)
12870167 the M416V polymorphism of glycogen synthase 1 gene is not associated with insulin resistance in type 2 diabetes
12732844 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12411100 Observational study of gene-disease association. (HuGE Navigator)
11147787 Observational study of gene-disease association. (HuGE Navigator)
11092303 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)

AA Sequence

MPLNRTLSMSSLPGLEDWEDEFDLENAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNYFLVGPYTE      1 - 70
QGVRTQVELLEAPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVGASAWALERWKGELWDTCNIG     71 - 140
VPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFHEWLAGVGLCLCRARRLPVATIFTTHATLLG    141 - 210
RYLCAGAVDFYNNLENFNVDKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPN    211 - 280
GLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLN    281 - 350
YLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML    351 - 420
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPEFLSSTSPLLP    421 - 490
VDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSL    491 - 560
DDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALSKAFPEHFTYEPNEADA    561 - 630
AQGYRYPRPASVPPSPSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCT    631 - 700
SSTSGSKRNSVDTATSSSLSTPSEPLSPTSSLGEERN                                     701 - 737
//

Text Mined References (69)

PMID Year Title
25703587 2015 Pathological glycogenesis through glycogen synthase 1 and suppression of excessive AMP kinase activity in myeloid leukemia cells.
25487600 2015 Overexpression of GYS1, MIF, and MYC is associated with adverse outcome and poor response to azacitidine in myelodysplastic syndromes and acute myeloid leukemia.
25416956 2014 A proteome-scale map of the human interactome network.
25371328 2015 Over-expression of muscle glycogen synthase in human diabetic nephropathy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24165324 2014 Leucine-rich repeat kinase 2 regulates tau phosphorylation through direct activation of glycogen synthase kinase-3?.
24049095 2013 Genome-wide association study of sex hormones, gonadotropins and sex hormone-binding protein in Chinese men.
23321478 2013 Akt2 influences glycogen synthase activity in human skeletal muscle through regulation of NH?-terminal (sites 2 + 2a) phosphorylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23134486 2013 Regulation of glycogen synthase from mammalian skeletal muscle--a unifying view of allosteric and covalent regulation.
22403297 2012 GLUT4 and glycogen synthase are key players in bed rest-induced insulin resistance.
21668450 2011 R3F, a novel membrane-associated glycogen targeting subunit of protein phosphatase 1 regulates glycogen synthase in astrocytoma cells in response to glucose and extracellular signals.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21356517 2011 Phosphate incorporation during glycogen synthesis and Lafora disease.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20384434 2010 Combining genetic markers and clinical risk factors improves the risk assessment of impaired glucose metabolism.
20300197 2010 Hypoxia promotes glycogen accumulation through hypoxia inducible factor (HIF)-mediated induction of glycogen synthase 1.
20017397 [The regulation of glucose-6-phosphate dehydrogenase and glycogen synthase activities by insulin superfamily peptides in myometrium of pregnant women and its impairments under different types of diabetes mellitus].
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19837931 2009 Dysregulation of glycogen synthase COOH- and NH2-terminal phosphorylation by insulin in obesity and type 2 diabetes mellitus.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19699667 2009 Identification of a novel mutation in GYS1 (muscle-specific glycogen synthase) resulting in sudden cardiac death, that is diagnosable from skin fibroblasts.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19339242 2009 Dual regulation of muscle glycogen synthase during exercise by activation and compartmentalization.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18544618 2008 Impaired insulin activation and dephosphorylation of glycogen synthase in skeletal muscle of women with polycystic ovary syndrome is reversed by pioglitazone treatment.
17928598 2007 Cardiomyopathy and exercise intolerance in muscle glycogen storage disease 0.
17356695 2007 Variation in GYS1 interacts with exercise and gender to predict cardiovascular mortality.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17137217 2006 Association of sixty-one non-synonymous polymorphisms in forty-one hypertension candidate genes with blood pressure variation and hypertension.
17055998 2006 Interaction between glycogenin and glycogen synthase.
16282323 2006 Evidence that Ser87 of BimEL is phosphorylated by Akt and regulates BimEL apoptotic function.
16275910 2005 Control of mammalian glycogen synthase by PAS kinase.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15955076 2005 Determinants of the nucleocytoplasmic shuttling of muscle glycogen synthase.
15855312 2005 Impact of genetic versus environmental factors on the control of muscle glycogen synthase activation in twins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15282316 2004 Abnormal cardiac development in the absence of heart glycogen.
15194499 2004 The primary defect in glycogen synthase activity is not based on increased glycogen synthase kinase-3alpha activity in diabetic myotubes.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12870167 2003 Association of muscle glycogen synthase polymorphism with insulin resistance in type 2 diabetic patients.
12732844 2003 A study to survey susceptible genetic factors responsible for troglitazone-associated hepatotoxicity in Japanese patients with type 2 diabetes mellitus.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411100 2002 Association of GYS1 and beta(3)-AR gene with postprandial hyperglycemia and serum uric acid in type 2 diabetes mellitus.
11427888 2001 Structure of GSK3beta reveals a primed phosphorylation mechanism.
11251056 2001 Glycogen synthase localization and activity in rat skeletal muscle is strongly dependent on glycogen content.
11147787 2001 The stimulation-induced increase in skeletal muscle glycogen synthase content is impaired in carriers of the glycogen synthase XbaI gene polymorphism.
11092303 2000 The Met416-->Val variant in the glycogen synthase gene: the prevalence and the association with diabetes in a large number of Japanese individuals. Study Group for the Identification of Type 2 Diabetes Genes in Japanese.
10924520 2000 Identification of two essential glutamic acid residues in glycogen synthase.
9628874 1998 PRAK, a novel protein kinase regulated by the p38 MAP kinase.
9346895 1997 Glycogenin-2, a novel self-glucosylating protein involved in liver glycogen biosynthesis.
9010351 1996 Cloning and characterization of a glycogen synthase cDNA from human endometrium.
8449521 1993 Assignment of the gene encoding glycogen synthase (GYS) to human chromosome 19, band q13.3.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8062946 1994 Characterization of human endometrial glycogen synthase.
7657035 1995 Isolation and characterization of the human muscle glycogen synthase gene.
7631777 1995 Increased concentrations of glycogen synthase protein in skeletal muscle of patients with NIDDM.
6772446 1980 Glycogen synthase from rabbit skeletal muscle. Amino acid sequence at the sites phosphorylated by glycogen synthase kinase-3, and extension of the N-terminal sequence containing the site phosphorylated by phosphorylase kinase.
2493642 1989 Human muscle glycogen synthase cDNA sequence: a negatively charged protein with an asymmetric charge distribution.
2117608 1990 Phosphate groups as substrate determinants for casein kinase I action.