Property Summary

NCBI Gene PubMed Count 51
PubMed Score 365.53
PubTator Score 27.83

Knowledge Summary

Patent

No data available

Gene RIF (15)

PMID Text
24858913 MNSs blood group glycophorin variants in Taiwan: a genotype-serotype correlation study of 'Mi(a)' and St(a) with report of two new alleles for St(a).
24738877 A novel GYPB mutation (c.270+5G>A) accounting for the S-s-U+(var) phenotype was identified.
21883272 Substitution of GPB with Gp.Mur significantly reduced the expression of Rh antigen and RhAG on the Mi.III(+/+) erythrocyte membrane
21283638 an increased susceptibility to infection by this parasite is associated with the glycophorin B S+ variant in Brazilian Amazons
20431033 Observational study of genetic testing. (HuGE Navigator)
19856717 This study reports for the first time the molecular mechanisms responsible for the S-s- phenotype in a population of African Brazilians and provides new information about the frequency and molecular bases of the GYPB*S silent gene in this population.
19279206 The erythrocyte-binding domain, region 2 of EBL-1, bound glycophorin B(+) but
18510579 Observational study of genetic testing. (HuGE Navigator)
18284304 Immunoblotting showed the presence of monomer and dimer forms of a GP(A-B) hybrid and an absence of GPA and GPB. Sequencing of DNA and PCR-RFLP using the restriction enzyme RsaI confirmed the presence of a hybrid GYP(AB).
18067501 Observational study of genetic testing. (HuGE Navigator)
17561857 Alternative to conventional tube technique for mass screening for MNS hybrids, especially when specific antisera are not available.
17372674 Observational study of gene-disease association. (HuGE Navigator)
17372674 GYPA & GYPB genotypes carrying MNSs antigens were analyzed in Thai patients with cerebral malaria & mild malaria; no statistical difference was found; it is concluded that MNSs antigens do not reveal the difference in susceptibility to cerebral malaria
14641872 The S-s-U+var phenotype arises from changes in or around GYPB exon 5.
14638759 Indochina I strain of P. falciparum is not dependent on glycophorin B to invade erythrocytse through a trypsin-resistant pathway as are the strains 3D7, HB3, and Dd2.

AA Sequence

MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCV      1 - 70
MAGIIGTILLISYSIRRLIKA                                                      71 - 91
//

Text Mined References (53)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24916810 2014 MN typing discrepancies based on GYPA-B-A hybrid.
24858913 2014 MNSs blood group glycophorin variants in Taiwan: a genotype-serotype correlation study of 'Mi(a)' and St(a) with report of two new alleles for St(a).
24738877 2014 Family study of a Swiss patient uncovered a novel genetic basis for the S-s-U+(var) phenotype.
23944874 2014 Identification of binding domains on red blood cell glycophorins for Babesia divergens.
23756267 2013 Assessing the frequencies of GP.Mur (Mi.III) in several Southeast Asian populations by PCR typing.
23049422 2012 Molecular analysis of the GYPB gene to infer S, s, and U phenotypes in an admixed population of Minas Gerais, Brazil.
22924868 2013 A direct blood polymerase chain reaction approach for the determination of GP.Mur (Mi.III) and other Hil+ Miltenberger glycophorin variants.
21883272 2012 Expression of the Rh/RhAG complex is reduced in Mi.III erythrocytes.
21880045 2012 Anti-U-like as an alloantibody in S-s-U- and S-s-U+(var) black people.
21664997 2011 Effects of natural selection and gene conversion on the evolution of human glycophorins coding for MNS blood polymorphisms in malaria-endemic African populations.
21283638 2011 Population genetics of GYPB and association study between GYPB*S/s polymorphism and susceptibility to P. falciparum infection in the Brazilian Amazon.
20431033 2010 Single PCR multiplex SNaPshot reaction for detection of eleven blood group nucleotide polymorphisms: optimization, validation, and one year of routine clinical use.
20406014 2009 MNS blood group system: a review.
19856717 2008 Molecular analyses of GYPB in African Brazilians.
19564639 2009 Miltenberger blood group antigen type III (Mi.III) enhances the expression of band 3.
19279206 2009 Glycophorin B is the erythrocyte receptor of Plasmodium falciparum erythrocyte-binding ligand, EBL-1.
18510579 2008 Introduction of a real-time-based blood-group genotyping approach.
18284304 2007 An alloantibody to a high-prevalence MNS antigen in a person with a GP.JL/Mk phenotype.
18067501 2008 Blood group genotyping for Jk(a)/Jk(b), Fy(a)/Fy(b), S/s, K/k, Kp(a)/Kp(b), Js(a)/Js(b), Co(a)/Co(b), and Lu(a)/Lu(b) with microarray beads.
17561857 2007 Detection of MNS hybrid molecules in the Thai population using PCR-SSP technique.
17372674 2007 The genotypes of GYPA and GYPB carrying the MNSs antigens are not associated with cerebral malaria.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14641872 2003 Mutations in GYPB exon 5 drive the S-s-U+(var) phenotype in persons of African descent: implications for transfusion.
14638759 2003 Plasmodium falciparum is able to invade erythrocytes through a trypsin-resistant pathway independent of glycophorin B.
12949139 2003 Rapidly evolving genes in human. I. The glycophorins and their possible role in evading malaria parasites.
12869123 2003 Quantification of glycophorin A and glycophorin B on normal human RBCs by flow cytometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11239234 2001 The low-incidence MNS antigens M(v), s(D), and Mit arise from single amino acid substitutions on GPB.
10827259 2000 Identification of a novel hybrid glycophorin gene encoding GP.Hop.
9269716 1997 Molecular genetics of glycophorin MNS variants.
8563755 1996 Candidate gene acting as a suppressor of the RH locus in most cases of Rh-deficiency.
8535438 1995 Molecular genetics of the glycophorin gene family, the antigens for MNSs blood groups: multiple gene rearrangements and modulation of splice site usage result in extensive diversification.
8444872 1993 Exon skipping caused by DNA recombination that introduces a defective donor splice site into the human glycophorin A gene.
8193374 1994 Glycophorin He(Sta) of the human red blood cell membrane is encoded by a complex hybrid gene resulting from two recombinational events.
8144668 1994 Remodeling of the transmembrane segment in human glycophorin by aberrant RNA splicing.
7806496 1994 Post-transcriptional regulation of the cell surface expression of glycophorins A, B, and E.
7798177 1994 Characterization of glycophorin A transcripts: control by the common erythroid-specific promoter and alternative usage of different polyadenylation signals.
7681597 1993 Epitopic structure of Tn glycophorin A for an anti-Tn antibody (MLS 128).
7622054 1995 Detailed physical mapping of the genes encoding glycophorins A, B and E, as revealed by P1 plasmids containing human genomic DNA.
3595615 1987 Hybrid glycophorins from human erythrocyte membranes. I. Isolation and complete structural analysis of the hybrid sialoglycoprotein from Dantu-positive red cells of the N.E. variety.
3571235 1987 Glycophorins B and C from human erythrocyte membranes. Purification and sequence analysis.
3477806 1987 Molecular cloning of a human glycophorin B cDNA: nucleotide sequence and genomic relationship to glycophorin A.
3196288 1988 Isolation of cDNA clones for human erythrocyte membrane sialoglycoproteins alpha and delta.
2734312 1989 Structural organization of glycophorin A and B genes: glycophorin B gene evolved by homologous recombination at Alu repeat sequences.
2295603 1990 Identification of a novel human glycophorin, glycophorin E, by isolation of genomic clones and complementary DNA clones utilizing polymerase chain reaction.
2016325 1991 Molecular genetics of human erythrocyte MiIII and MiVI glycophorins. Use of a pseudoexon in construction of two delta-alpha-delta hybrid genes resulting in antigenic diversification.
2015404 1991 Identification of recombination events resulting in three hybrid genes encoding human MiV, MiV(J.L.), and Sta glycophorins.
1971625 1990 Identification of the crossing-over point of a hybrid gene encoding human glycophorin variant Sta. Similarity to the crossing-over point in haptoglobin-related genes.
1737789 1992 Gene conversion confined to a direct repeat of the acceptor splice site generates allelic diversity at human glycophorin (GYP) locus.
1611092 1992 Molecular basis for the human erythrocyte glycophorin specifying the Miltenberger class I (MiI) phenotype.