Property Summary

NCBI Gene PubMed Count 85
PubMed Score 1160.75
PubTator Score 343.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -7.274 6.7e-09
mucosa-associated lymphoid tissue lympho... 5.643 5.3e-03
sarcoidosis 1.200 2.0e-02

Gene RIF (41)

PMID Text
26239059 Glycophorin-A-rich microparticles are released from evolving growing thrombi into the distal perfusing blood, and can be measured in peripheral blood. CD235a(+) cMPs may constitute a novel systemic biomarker of ongoing thrombosis.
25778531 GPA-deficient band 3 null erythrocytes are resistant to malaria infection.
25628009 The authors demonstrate that the initial vacuolar membrane around internalized Babesia divergens is formed from protein and lipid components of the red blood cells plasma membrane, including band 3, glycophorin A and spectrin.
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of glycophorin A (GYPA, CD235a)
25205096 PfEBA-175 engages multiple glycans of GpA encoded by exon 3 and that the presentation of glycans is likely required for high-avidity binding.
24858913 MNSs blood group glycophorin variants in Taiwan: a genotype-serotype correlation study of 'Mi(a)' and St(a) with report of two new alleles for St(a).
24043627 These data demonstrate the importance of PfEBA175 regions other than the DBL domains in the interaction with GYPA and merit their inclusion in an EBA175-based vaccine.
23722820 The expression of glycophorin A and osteoprotegerin is locally increased in carotid atherosclerotic lesions of symptomatic compared to asymptomatic patients.
21455273 Data suggest that glycophorin A (Gpa) increases expression and activity of Cl-/HCO3- exchanger Ae1, that G719D mutation renders Ae1 mutant constructs GPA-unresponsive, and suggests a role for Ae1 amino acids 22-28 in GPA responsiveness.
21119205 the GG genotype of the rs 1489759 HHIP single-nucleotide polymorphism (SNP) and the CC genotype of the rs 2202507 GYPA SNP confers a ''protective'' effect on COPD (OR 0.59, p50.006 for HHIP and OR50.65, p50.006 for GYPA) and lung cancer.
21072853 Beta-branched residues adjacent to GG4 motifs promote the efficient association of glycophorin A transmembrane helices.
20603102 Data indicate that changes of the glycophorin A dimerization propensities in different lipid bilayers suggest that the lipid bilayer thickness severely influences the monomer-dimer equilibrium of the transmembrane domain.
20560530 Observational study of genetic testing. (HuGE Navigator)
20434428 ABH blood group antigens in N-glycan of human glycophorin A.
20233359 The Sta gene found in this family has A246 & C252, C302, and G307. The putative crossing-over point is between nucleotides 252 to 302 in Intron 3.
20074546 Energy transfer between differently labelled glycophorin A transmembrane helices decreased with increasing Sodium Dodecyl Sulfate mole fractions albeit without modifying the helicity of the peptides.
19907019 Heterozygous missense mutation E758K in the human AE1/SLC4A1/band 3 gene in two unrelated patients with well-compensated hereditary spherostomatocytic anemia induces glycophorin A-independent, endogenous cation transport.
19438409 AE1 and GPA form a complex in the endoplasmic reticulum of human K562 cells.
19071041 GPA depletion does not alter band 3's native conformation at the DIDS binding site. It modulates a conformational equilibrium between 2 states of the binary complex formed by the competitive inhibitor DIDS, reversibly bound to properly folded band 3.
18510579 Observational study of genetic testing. (HuGE Navigator)
17456399 GPA-NN mutagens contributed to the pathogenesis of chronic benzene poisoning.
17456399 Observational study of gene-disease association. (HuGE Navigator)
17452518 single mutations in glycophorin A can result in the observed fourth power relationship with age of oncet in polycythemia rubra vera
17372674 Observational study of gene-disease association. (HuGE Navigator)
17372674 GYPA & GYPB genotypes carrying MNSs antigens were analyzed in Thai patients with cerebral malaria & mild malaria; no statistical difference was found; it is concluded that MNSs antigens do not reveal the difference in susceptibility to cerebral malaria
16424825 glycophorin A somatic mutation frequency levels in newborns are not related to maternal lifestyle factors or drug metabolizing enzyme genotypes
16205834 This study demonstrates the systematic classification of ten alleles (five M and five N alleles) of the MN blood group system to major or minor variations of the standard alleles.
16179731 Both HIV-1 Nef and Vpu downregulate the cell surface expression of glycophorin A (GYPA, CD235a)
16003235 Porcine Kupffer cells bind xenogeneic human RBC by recognition of a carbohydrate epitope on glycophorin A.
15819453 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15783300 Observational study of genotype prevalence. (HuGE Navigator)
15761857 Observational study of gene-disease association. (HuGE Navigator)
15754970 Observational study of genotype prevalence. (HuGE Navigator)
14604989 band 3 in the red cell can take up two different structures: one with high anion transport activity when glycophorin A is present and one with lower anion transport activity when glycophorin A is absent
14550622 Observational study of genotype prevalence. (HuGE Navigator)
12813056 Distinct regions of human glycophorin A enhance human red cell anion exchanger transport function and surface trafficking
12492375 Somatic cell mutations found at the gene locus in erythrocytes of radiation workers at a nuclear facility
12189808 Observational study of genotype prevalence. (HuGE Navigator)
12165956 Observational study of genotype prevalence. (HuGE Navigator)
11936216 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11861881 Natural selection of polymorphisms/variants on the erythrocyte surface

AA Sequence

MYGKIIFVLLLSEIVSISASSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTV      1 - 70
YPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSV     71 - 140
EIENPETSDQ                                                                141 - 150
//

Text Mined References (103)

PMID Year Title
26239059 2015 Growing thrombi release increased levels of CD235a(+) microparticles and decreased levels of activated platelet-derived microparticles. Validation in ST-elevation myocardial infarction patients.
25778531 2015 Merozoite surface protein 1 recognition of host glycophorin A mediates malaria parasite invasion of red blood cells.
25628009 2015 The apicomplexan parasite Babesia divergens internalizes band 3, glycophorin A and spectrin during invasion of human red blood cells.
25205096 2014 Critical glycosylated residues in exon three of erythrocyte glycophorin A engage Plasmodium falciparum EBA-175 and define receptor specificity.
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
25101718 2015 IREB2 and GALC are associated with pulmonary artery enlargement in chronic obstructive pulmonary disease.
24858913 2014 MNSs blood group glycophorin variants in Taiwan: a genotype-serotype correlation study of 'Mi(a)' and St(a) with report of two new alleles for St(a).
24322204 2014 Genome-wide association study of bipolar disorder accounting for effect of body mass index identifies a new risk allele in TCF7L2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24043627 2013 Biochemical analysis of the Plasmodium falciparum erythrocyte-binding antigen-175 (EBA175)-glycophorin-A interaction: implications for vaccine design.
23722820 2013 The expression of glycophorin A and osteoprotegerin is locally increased in carotid atherosclerotic lesions of symptomatic compared to asymptomatic patients.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21455273 2011 Interactions of mouse glycophorin A with the dRTA-related mutant G719D of the mouse Cl-/HCO3- exchanger Ae1.
21119205 2010 Chromosome 4q31 locus in COPD is also associated with lung cancer.
21072853 2011 Beta-branched residues adjacent to GG4 motifs promote the efficient association of glycophorin A transmembrane helices.
20603102 2010 The membrane environment modulates self-association of the human GpA TM domain--implications for membrane protein folding and transmembrane signaling.
20560530 2010 Robust, high-throughput solution for blood group genotyping.
20434428 2010 ABH blood group antigens in N-glycan of human glycophorin A.
20233359 2010 A new isoform of Sta gene found in a family with NOR polyagglutination.
20173748 2010 Variants in FAM13A are associated with chronic obstructive pulmonary disease.
20074546 2010 Unfolding a transmembrane helix dimer: A FRET study in mixed micelles.
20010835 2010 Meta-analyses of genome-wide association studies identify multiple loci associated with pulmonary function.
20010834 2010 Genome-wide association study identifies five loci associated with lung function.
19907019 2010 The GPA-dependent, spherostomatocytosis mutant AE1 E758K induces GPA-independent, endogenous cation transport in amphibian oocytes.
19438409 2009 Interaction of anion exchanger 1 and glycophorin A in human erythroleukaemic K562 cells.
19300500 2009 A genome-wide association study of pulmonary function measures in the Framingham Heart Study.
19071041 Kinetic evidence for modulation by glycophorin A of a conformational equilibrium between two states of band 3 (SLC4A1) bound reversibly by the competitive inhibitor DIDS.
18510579 2008 Introduction of a real-time-based blood-group genotyping approach.
18380804 2008 Hsa, an adhesin of Streptococcus gordonii DL1, binds to alpha2-3-linked sialic acid on glycophorin A of the erythrocyte membrane.
17456399 2007 [Association of the glycophorin A gene mutation in peripheral erythrocytes and chronic benzene poisoning].
17452518 2007 JAK2 617V>F positive polycythemia rubra vera maintained by approximately 18 stochastic stem-cell divisions per year, explaining age of onset by a single rate-limiting mutation.
17372674 2007 The genotypes of GYPA and GYPB carrying the MNSs antigens are not associated with cerebral malaria.
16424825 2006 The absence of interaction between drug metabolizing enzyme genotypes and maternal lifestyle factors on glycophorin A somatic mutation frequency levels in newborns.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16205834 2005 Systematic classification of alleles of the glycophorin A (MN blood group) gene.
16003235 2005 Carbohydrates borne on human glycophorin A are recognized by porcine Kupffer cells.
15819453 2004 Polymorphism of the serum alpha-amylase in the population of the South Central and South Eastern regions of Bulgaria and its relationship with the erythrocyte blood group systems ABO and MNSs.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15783300 2005 ABO, Rh, MNS, Duffy, Kidd,Yt, Scianna, and Colton blood group systems in indigenous Chinese.
15761857 2005 Adaptation to past malarial endemia and susceptibility to common diseases in modern populations: a study of adenosine deaminase and MN blood group genetic polymorphisms.
15754970 2004 Genetic characterization of the population of Grande Comore Island (Njazidja) according to major blood groups.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15331714 2004 Capsid region involved in hepatitis A virus binding to glycophorin A of the erythrocyte membrane.
15313217 2004 ABH blood group antigens in O-glycans of human glycophorin A.
15067009 2004 Dimerization of the transmembrane domain of Integrin alphaIIb subunit in cell membranes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14604989 2004 Altered structure and anion transport properties of band 3 (AE1, SLC4A1) in human red cells lacking glycophorin A.
14550622 2003 Polymorphism of LDLR, GYPA, HBGG, D7S8, GC, HLA-DQA1, Ig-JH, D17S30, ApoB and D1S80 loci in northwestern Russians.
12949139 2003 Rapidly evolving genes in human. I. The glycophorins and their possible role in evading malaria parasites.
12813056 2003 Distinct regions of human glycophorin A enhance human red cell anion exchanger (band 3; AE1) transport function and surface trafficking.
12492375 2003 Somatic cell mutations at the glycophorin a locus in erythrocytes of radiation workers from the Sellafield nuclear facility.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12189808 Nicaraguan population data on LDLR, GYPA, D7S8, HBGG, GC and HLA-DQA1 loci.
12165956 [Distribution of HLA DQA1, LDLR, GYPA, HBGG, D7S8, and GC locus alleles in the population of Russia].
11936216 2002 Influence of polymorphism of GSTM1 gene on association between glycophorin a mutant frequency and urinary PAH metabolites in incineration workers.
11402026 2001 In vivo detection of hetero-association of glycophorin-A and its mutants within the membrane.
11313283 2001 Glycophorin A dimerization and band 3 interaction during erythroid membrane biogenesis: in vivo studies in human glycophorin A transgenic mice.
10926825 2000 Red-cell glycophorin A-band 3 interactions associated with the movement of band 3 to the cell surface.
10912628 2000 Identification of blood group A and B antigens in human glycophorin.
10827258 2000 The low-frequency MNS blood group antigens Ny(a) (MNS18) and Os(a) (MNS38) are associated with GPA amino acid substitutions.
10729812 2000 The MNS blood group antigens, Vr (MNS12) and Mt(a) (MNS14), each arise from an amino acid substitution on glycophorin A.
10644812 2000 Genomic typing of human red cell miltenberger glycophorins in a Taiwanese population.
10354388 1999 Glycophorin A mutation Ala65 --> Pro gives rise to a novel pair of MNS alleles ENEP (MNS39) and HAG (MNS41) and altered Wrb expression: direct evidence for GPA/band 3 interaction necessary for normal Wrb expression.
9490702 1998 Complete deficiency of glycophorin A in red blood cells from mice with targeted inactivation of the band 3 (AE1) gene.
9269716 1997 Molecular genetics of glycophorin MNS variants.
9082985 1997 A transmembrane helix dimer: structure and implications.
8953647 1996 Improved prediction for the structure of the dimeric transmembrane domain of glycophorin A obtained through global searching.
8535438 1995 Molecular genetics of the glycophorin gene family, the antigens for MNSs blood groups: multiple gene rearrangements and modulation of splice site usage result in extensive diversification.
8444872 1993 Exon skipping caused by DNA recombination that introduces a defective donor splice site into the human glycophorin A gene.
8286855 1993 Glycosylation sites identified by solid-phase Edman degradation: O-linked glycosylation motifs on human glycophorin A.
8245024 1993 Alteration of splice site selection by an exon mutation in the human glycophorin A gene.
8193374 1994 Glycophorin He(Sta) of the human red blood cell membrane is encoded by a complex hybrid gene resulting from two recombinational events.
8009226 1994 Receptor and ligand domains for invasion of erythrocytes by Plasmodium falciparum.
7798177 1994 Characterization of glycophorin A transcripts: control by the common erythroid-specific promoter and alternative usage of different polyadenylation signals.
7762218 1995 Molecular characterization of glycophorin A transcripts in human erythroid cells using RT-PCR, allele-specific restriction, and sequencing.
7718894 1995 Glycophorin SAT of the human erythrocyte membrane is specified by a hybrid gene reciprocal to glycophorin Dantu gene.
7622054 1995 Detailed physical mapping of the genes encoding glycophorins A, B and E, as revealed by P1 plasmids containing human genomic DNA.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.
7040988 1982 Erythrocytes deficiency in glycophorin resist invasion by the malarial parasite Plasmodium falciparum.
6940143 1981 Amino acid and carbohydrate structural variants of glycoprotein products (M-N glycoproteins) of the M-N allelic locus.
6166001 1981 Mg and Mc: mutations within the amino-terminal region of glycophorin A.
5350948 1969 Structural studies on human erythrocyte glycoproteins. Alkali-labile oligosaccharides.
3809885 1986 Molecular biological study of the structure and expression of human glycophorin A.
3624241 1987 Structures of novel sialylated O-linked oligosaccharides isolated from human erythrocyte glycophorins.
3477806 1987 Molecular cloning of a human glycophorin B cDNA: nucleotide sequence and genomic relationship to glycophorin A.
3456608 1986 Isolation and characterization of human glycophorin A cDNA clones by a synthetic oligonucleotide approach: nucleotide sequence and mRNA structure.
3345758 1988 Characterization of cDNA clones for human glycophorin A. Use for gene localization and for analysis of normal of glycophorin-A-deficient (Finnish type) genomic DNA.
3198123 1988 A family study of multiple mutations of alpha and delta glycophorins (glycophorins A and B).
3196288 1988 Isolation of cDNA clones for human erythrocyte membrane sialoglycoproteins alpha and delta.
2792104 1989 Molecular analysis of glycophorin A and B gene structure and expression in homozygous Miltenberger class V (Mi. V) human erythrocytes.
2753361 1989 Isolation of the cDNA clone for mouse glycophorin, erythroid-specific membrane protein.
2734312 1989 Structural organization of glycophorin A and B genes: glycophorin B gene evolved by homologous recombination at Alu repeat sequences.
2386609 1990 One- and two-dimensional NMR studies of the N-terminal portion of glycophorin A at 11.7 Tesla.
2216775 1990 The mechanism of production of multiple mRNAs for human glycophorin A.
2016325 1991 Molecular genetics of human erythrocyte MiIII and MiVI glycophorins. Use of a pseudoexon in construction of two delta-alpha-delta hybrid genes resulting in antigenic diversification.
2015404 1991 Identification of recombination events resulting in three hybrid genes encoding human MiV, MiV(J.L.), and Sta glycophorins.
1932122 1991 A variant of glycophorin A resulting from the deletion of exon 4.
1737789 1992 Gene conversion confined to a direct repeat of the acceptor splice site generates allelic diversity at human glycophorin (GYP) locus.
1611092 1992 Molecular basis for the human erythrocyte glycophorin specifying the Miltenberger class I (MiI) phenotype.
1560003 1992 Glycophorin A dimerization is driven by specific interactions between transmembrane alpha-helices.
1463744 1992 The glycophorin A transmembrane domain dimer: sequence-specific propensity for a right-handed supercoil of helices.
1421409 1992 Molecular analysis of human glycophorin MiIX gene shows a silent segment transfer and untemplated mutation resulting from gene conversion via sequence repeats.
1059087 1975 Amino-acid sequence and oligosaccharide attachment sites of human erythrocyte glycophorin.