Property Summary

NCBI Gene PubMed Count 13
PubMed Score 86.90
PubTator Score 30.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
posterior fossa group A ependymoma 2.500 6.4e-09
oligodendroglioma 1.100 3.3e-02
psoriasis -1.600 1.1e-02
osteosarcoma 2.539 1.4e-04
atypical teratoid / rhabdoid tumor 1.300 4.5e-05
Atopic dermatitis -1.500 4.3e-02
pancreatic ductal adenocarcinoma liver m... -1.123 3.6e-03
intraductal papillary-mucinous adenoma (... 2.000 3.5e-04
intraductal papillary-mucinous neoplasm ... 2.000 2.8e-03
colon cancer 1.200 2.5e-02
breast carcinoma -2.300 1.9e-03
fibroadenoma -3.100 2.3e-02
ductal carcinoma in situ -3.700 2.4e-04
invasive ductal carcinoma -4.300 2.8e-04
ovarian cancer 1.700 2.2e-02

Gene RIF (2)

PMID Text
25751106 This is the first evaluation of humans without GN2 expression. Our data indicate that GN2 is not required for liver glycogen synthesis and glucagon-stimulated glucose release.
24239874 The glucosylation of glycogenin-2 was enhanced to 2-4 glucose units by the co-presence of enzymatically active glycogenin-1.

AA Sequence

MSETEFHHGAQAGLELLRSSNSPTSASQSAGMTVTDQAFVTLATNDIYCQGALVLGQSLRRHRLTRKLVV      1 - 70
LITPQVSSLLRVILSKVFDEVIEVNLIDSADYIHLAFLKRPELGLTLTKLHCWTLTHYSKCVFLDADTLV     71 - 140
LSNVDELFDRGEFSAAPDPGWPDCFNSGVFVFQPSLHTHKLLLQHAMEHGSFDGADQGLLNSFFRNWSTT    141 - 210
DIHKHLPFIYNLSSNTMYTYSPAFKQFGSSAKVVHFLGSMKPWNYKYNPQSGSVLEQGSASSSQHQAAFL    211 - 280
HLWWTVYQNNVLPLYKSVQAGEARASPGHTLCHSDVGGPCADSASGVGEPCENSTPSAGVPCANSPLGSN    281 - 350
QPAQGLPEPTQIVDETLSLPEGRRSEDMIACPETETPAVITCDPLSQPSPQPADFTETETILQPANKVES    351 - 420
VSSEETFEPSQELPAEALRDPSLQDALEVDLAVSVSQISIEEKVKELSPEEERRKWEEGRIDYMGKDAFA    421 - 490
RIQEKLDRFLQ                                                               491 - 501
//

Text Mined References (16)

PMID Year Title
25751106 2015 Glycogenin-2 is dispensable for liver glycogen synthesis and glucagon-stimulated glucose release.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24239874 2014 LC-MS/MS characterization of combined glycogenin-1 and glycogenin-2 enzymatic activities reveals their self-glucosylation preferences.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12051921 2002 Crystal structure of the autocatalytic initiator of glycogen biosynthesis, glycogenin.
11840567 2002 Cluster analysis of an extensive human breast cancer cell line protein expression map database.
10721716 2000 Structure and chromosomal localization of the human glycogenin-2 gene GYG2.
9857012 1998 Characterization of human glycogenin-2, a self-glucosylating initiator of liver glycogen metabolism.
9691087 1998 Mutations in the liver glycogen synthase gene in children with hypoglycemia due to glycogen storage disease type 0.
9346895 1997 Glycogenin-2, a novel self-glucosylating protein involved in liver glycogen biosynthesis.
1281472 1992 Rabbit skeletal muscle glycogenin. Molecular cloning and production of fully functional protein in Escherichia coli.