Property Summary

NCBI Gene PubMed Count 27
PubMed Score 75.83
PubTator Score 41.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma 1.300 2.1e-02
colon cancer -1.700 4.9e-05
group 3 medulloblastoma -1.100 4.4e-03
intraductal papillary-mucinous adenoma (... -1.400 1.0e-03
intraductal papillary-mucinous carcinoma... -1.200 1.9e-02
intraductal papillary-mucinous neoplasm ... -1.500 6.5e-03
medulloblastoma, large-cell -1.200 9.4e-03
Multiple myeloma 1.465 1.3e-03
osteosarcoma -2.255 6.2e-07
ovarian cancer -1.900 4.8e-08
pituitary cancer -1.600 3.0e-05
Waldenstrons macroglobulinemia 1.306 1.9e-02

Protein-protein Interaction (1)

PDB (12)

Gene RIF (7)

AA Sequence

MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSA      1 - 70
HLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQ     71 - 140
PSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKV    141 - 210
VHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVLSDL    211 - 280
VYTLAFSCGFCRKEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ    281 - 350
//

Text Mined References (31)

PMID Year Title