Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.79
PubTator Score 1.42

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MKLRSKAAALLLLALAALLLALLSLRAGRAEPPALPARPASAPQRHPAPVPARWPGPGALPGASPGVRRR      1 - 70
RPPRPRPRAGRRGAARLEKLARRPGEPRSFQAVLPPELWIHLAVVACGNRLEETLVMLKSAVLFSHRKIQ     71 - 140
FHIFTEDSLKPEFDKQLRQWPDSYTKKFEHRIYPITFSVGNPQEWKKLFKPCAAQRLFLPVILKDVDSLL    141 - 210
YVDTDVLFLRPVDDIWKLLRLFNSTQLAAMAPEHEIPKIGWYSRFARHPFYGSAGVNSGVMLMNLTRIRS    211 - 280
TQFKNSMIPTGLAWEDMLYPLYQKYKNAITWGDQDLLNIIFYFNPECLYVFPCQWNYRPDHCMYGSNCRE    281 - 350
AEHEGVSVLHGNRGVYHDDKQPTFRALYEAIRDFPFQDNLFQSMYYPLQLKFLETVHTLCGRIPQVFLKQ    351 - 420
IEKTMKRAYEKHVIIHVGPNQMH                                                   421 - 443
//

Text Mined References (5)

PMID Year Title