Property Summary

NCBI Gene PubMed Count 11
PubMed Score 151.90
PubTator Score 17.86

Knowledge Summary

Patent (13,033)

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.368 2.0e-03
astrocytoma -2.000 1.2e-03
primary pancreatic ductal adenocarcinoma 1.236 7.6e-03
diabetes mellitus 2.800 1.8e-03
Pick disease -1.100 6.7e-06
Subcutaneous panniculitis-like T-cell ly... 1.100 4.8e-02
mucosa-associated lymphoid tissue lympho... 1.025 1.0e-02
ovarian cancer 2.900 5.0e-07
Breast cancer 1.300 1.4e-06
pancreatic cancer 1.200 1.1e-02

Protein-protein Interaction (5)

Gene RIF (1)

PMID Text
16832584 HGS and GUK1 were significantly over expressed in GH-secreting adenomas, compared with ACTH-secreting adenomas and nonfunctioning tumors, and with PRL-secreting adenomas, respectively.

AA Sequence

MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDF      1 - 70
IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTE     71 - 140
TEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA                 141 - 197
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16832584 2006 Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) and guanylate kinase 1 (GUK1) are differentially expressed in GH-secreting adenomas.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.
8663313 1996 Cloning, characterization, and modeling of mouse and human guanylate kinases.
8647247 1996 Human guanylate kinase (GUK1): cDNA sequence, expression and chromosomal localisation.
6260205 1981 Guanosine-5'-phosphate synthetase and guanosine-5'-phosphate kinase in rat hepatomas and kidney tumors.
6249178 1980 Evidence for the assignment of GUK 1 gene locus to 1q32 leads to q43 segment from gene dosage effect.
2164269 [Increase in 5'-nucleotidase and decrease in guanylate kinase activity in the brain and liver of irradiated rats].
211390 1978 Guanylate kinases from human erythrocytes, hog brain, and rat liver.