Property Summary

NCBI Gene PubMed Count 12
PubMed Score 131.11
PubTator Score 67.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
aldosterone-producing adenoma -1.002 1.6e-02
group 4 medulloblastoma 1.200 5.4e-03
intraductal papillary-mucinous carcinoma... 1.200 3.5e-02
lung cancer 1.300 1.9e-02
lung carcinoma 1.100 7.8e-10
medulloblastoma, large-cell 1.100 1.4e-02
osteosarcoma -1.871 3.5e-04
Pick disease -1.100 2.0e-06
progressive supranuclear palsy -1.100 5.3e-03

Gene RIF (3)

AA Sequence

MWTLVGRGWGCARALAPRATGAALLVAPGPRSAPTLGAAPESWATDRLYSSAEFKEKLDMSRFPVENIRN      1 - 70
FSIVAHVDHGKSTLADRLLELTGTIDKTKNNKQVLDKLQVERERGITVKAQTASLFYNCEGKQYLLNLID     71 - 140
TPGHVDFSYEVSRSLSACQGVLLVVDANEGIQAQTVANFFLAFEAQLSVIPVINKIDLKNADPERVENQI    141 - 210
EKVFDIPSDECIKISAKLGTNVESVLQAIIERIPPPKVHRKNPLRALVFDSTFDQYRGVIANVALFDGVV    211 - 280
SKGDKIVSAHTQKTYEVNEVGVLNPNEQPTHKLYAGQVGYLIAGMKDVTEAQIGDTLCLHKQPVEPLPGF    281 - 350
KSAKPMVFAGMYPLDQSEYNNLKSAIEKLTLNDSSVTVHRDSSLALGAGWRLGFLGLLHMEVFNQRLEQE    351 - 420
YNASVILTTPTVPYKAVLSSSKLIKEHREKEITIINPAQFPDKSKVTEYLEPVVLGTIITPDEYTGKIMM    421 - 490
LCEARRAVQKNMIFIDQNRVMLKYLFPLNEIVVDFYDSLKSLSSGYASFDYEDAGYQTAELVKMDILLNG    491 - 560
NTVEELVTVVHKDKAHSIGKAICERLKDSLPRQLFEIAIQAAIGSKIIARETVKAYRKNVLAKCYGGDIT    561 - 630
RKMKLLKRQAEGKKKLRKIGNVEVPKDAFIKVLKTQSSK                                   631 - 669
//

Text Mined References (12)

PMID Year Title