Property Summary

NCBI Gene PubMed Count 42
PubMed Score 196.49
PubTator Score 301.18

Knowledge Summary

Patent (28,673)

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... 2.300 3.3e-02
lung carcinoma 1.700 7.8e-07
ulcerative colitis -1.300 5.8e-04

Gene RIF (29)

PMID Text
26773096 Findings show how caloric suppression of the guanylin-GUCY2C signaling axis links obesity to negation of a universal tumor suppressor pathway in colorectal cancer.
25370039 Data show that individuals affected with meconium ileus (MI) had either homozygous or compound heterozygous variants in enterotoxin receptor GUCY2C.
25064385 Transmission disequilibrium tests (TDT), case-control studies and quantitative analyses indicated association between GUC2C with Attention-deficit/hyperactivitydisorder and its core symptoms.
24919572 High guanylyl cyclase C expression is associated with colon cancer recurrence.
24217248 Intestinal cell proliferation and senescence are regulated by receptor guanylyl cyclase C and p21.
24085786 GUCY2C signaling constitutes a direct link between the initiation of colorectal cancer and the induction of its associated desmoplastic stromal niche.
23269669 Interaction with VIP36 is dependent on glycosylation at the same sites that allow GC-C to fold and bind ligand.
23150200 Data show that lower survival (OS) and disease-free survival (DFS) rates were significantly associated with guanylate cyclase C (GCC) and CK20 mRNA levels.
22521417 Mutations in GUCY2C were associated with the Meconium ileus phenotype. downregulation of GUCY2C leads to a cystic fibrosis-like intestinal phenotype.
22436048 We identified a heterozygous missense mutation (c.2519G-->T) in GUCY2C in all family members with familial diarrhea syndrome.
22384056 GUCY2C opposes systemic genotoxic tumorigenesis by regulating AKT-dependent intestinal barrier integrity
21901559 Data suggest that monitoring the peripheral blood GCC expressions may allow employing different treatment options to metastatic CRC patients.
21577013 Longer survival was associated with hypomethylation at specific CpG sites (e.g. GREB1, TGIF and TOB1) and hypermethylation in other genes (e.g. TMCO5, PTPRN and GUCY2C).
21533822 High guanylyl cyclase C is associated with colon cancer.
21307149 Lymph nodes (range: 2-159) from 291 prospectively enrolled node-negative colorectal cancer patients were analyzed by histopathology and GUCY2C quantitative RT-PCR.
19895223 Results suggest that GUCY2C quantitative reverse transcriptase (qRT)-PCR can be used to detect occult lymph node metastases in pN0 colorectal cancer patients.
19694825 GCC is a specific marker for differentiating primary and secondary metatstatic ovarian mucinous neoplasms.
19648115 the role of the linker region in receptor guanylyl cyclases
19620276 docking of the c-src SH2 domain to phosphorylated GC-C results in colocalization and further activation of c-src.
16899600 This validated assay is being applied to approximately 10,000 lymph nodes in a prospective trial to define the sensitivity of Guanylyl cyclase C(GCC) qRT-PCR for staging patients with colorectal cancer.
16618413 Transformation associated with reflux at the gastroesophageal junction reflects activation by bile acid and acid of a transcriptional program involving NF-kappaB and Cdx2, which mediate intestinal metaplasia and ectopic expression of GC-C.
15825168 Lack of guanylyl cyclase c expression assoeciated with significant reduction in adenomas in Apc(Min/+);Gucy2c(-/-) mice
14748740 a novel role for glycosidic modification of GC-C during its biosynthesis, in imparting subtle conformational changes in the receptor that allow for ligand-mediated activation and perhaps regulation of basal activity
14581363 gelatinolytic activity of GCC in colorectal tumor tissues may facilitate the hepatic metastatic process in the steps after intravasation but not during or before intravasation
12649275 SH3 domain -mediated protein-protein interaction with the catalytic domain of guanylyl cyclase C inhibited the cyclase activity and might be pivotal for the desensitization phenomenon of the guanylyl cyclase C receptor
12444076 Expression of the receptor guanylyl cyclase C and its ligands in reproductive tissues of the rat: a potential role for a novel signaling pathway in the epididymis.
12163327 guanylyl cyclase c is ectopically expressed in primary and metastatis adenocarcinoma of the esophagus and stomach
11950846 A novel PDZ protein regulates the activity of guanylyl cyclase C, the heat-stable enterotoxin receptor.
11478887 The protein kinase-like domain in receptor guanylyl cyclase C provides a critical structural link between the extracellular domain and the catalytic domain in regulation of this family of receptors.

AA Sequence

MKTLLLDLALWSLLFQPGWLSFSSQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNEGLEIVRGRLQ      1 - 70
NAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYSTFQMYLDTELSYP     71 - 140
MISAGSFGLSCDYKETLTRLMSPARKLMYFLVNFWKTNDLPFKTYSWSTSYVYKNGTETEDCFWYLNALE    141 - 210
ASVSYFSHELGFKVVLRQDKEFQDILMDHNRKSNVIIMCGGPEFLYKLKGDRAVAEDIVIILVDLFNDQY    211 - 280
FEDNVTAPDYMKNVLVLTLSPGNSLLNSSFSRNLSPTKRDFALAYLNGILLFGHMLKIFLENGENITTPK    281 - 350
FAHAFRNLTFEGYDGPVTLDDWGDVDSTMVLLYTSVDTKKYKVLLTYDTHVNKTYPVDMSPTFTWKNSKL    351 - 420
PNDITGRGPQILMIAVFTLTGAVVLLLLVALLMLRKYRKDYELRQKKWSHIPPENIFPLETNETNHVSLK    421 - 490
IDDDKRRDTIQRLRQCKYDKKRVILKDLKHNDGNFTEKQKIELNKLLQIDYYNLTKFYGTVKLDTMIFGV    491 - 560
IEYCERGSLREVLNDTISYPDGTFMDWEFKISVLYDIAKGMSYLHSSKTEVHGRLKSTNCVVDSRMVVKI    561 - 630
TDFGCNSILPPKKDLWTAPEHLRQANISQKGDVYSYGIIAQEIILRKETFYTLSCRDRNEKIFRVENSNG    631 - 700
MKPFRPDLFLETAEEKELEVYLLVKNCWEEDPEKRPDFKKIETTLAKIFGLFHDQKNESYMDTLIRRLQL    701 - 770
YSRNLEHLVEERTQLYKAERDRADRLNFMLLPRLVVKSLKEKGFVEPELYEEVTIYFSDIVGFTTICKYS    771 - 840
TPMEVVDMLNDIYKSFDHIVDHHDVYKVETIGDAYMVASGLPKRNGNRHAIDIAKMALEILSFMGTFELE    841 - 910
HLPGLPIWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPLRIHVSGSTIAILKRTECQFL    911 - 980
YEVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQRLQAEFSDMIANSLQKRQAAGIRSQKPRRV    981 - 1050
ASYKKGTLEYLQLNTTDKESTYF                                                  1051 - 1073
//

Text Mined References (46)

PMID Year Title
26773096 2016 Obesity-Induced Colorectal Cancer Is Driven by Caloric Silencing of the Guanylin-GUCY2C Paracrine Signaling Axis.
25370039 2015 Meconium ileus in a Lebanese family secondary to mutations in the GUCY2C gene.
25064385 2014 Association between GUC2C and ADHD: evidence from both categorical and quantitative traits.
24919572 2014 Molecular testing for lymph node metastases as a determinant of colon cancer recurrence: results from a retrospective multicenter study.
24217248 2014 Intestinal cell proliferation and senescence are regulated by receptor guanylyl cyclase C and p21.
24085786 2013 Intestinal GUCY2C prevents TGF-? secretion coordinating desmoplasia and hyperproliferation in colorectal cancer.
23269669 2013 Site-specific N-linked glycosylation of receptor guanylyl cyclase C regulates ligand binding, ligand-mediated activation and interaction with vesicular integral membrane protein 36, VIP36.
23150200 2013 Detection of circulating tumor cells in peripheral blood of colorectal cancer patients without distant organ metastases.
22521417 2012 Meconium ileus caused by mutations in GUCY2C, encoding the CFTR-activating guanylate cyclase 2C.
22436048 2012 Familial diarrhea syndrome caused by an activating GUCY2C mutation.
22384056 2012 GUCY2C opposes systemic genotoxic tumorigenesis by regulating AKT-dependent intestinal barrier integrity.
21901559 2011 Peripheral blood guanylyl cyclase c (GCC) expressions are associated with prognostic parameters and response to therapy in colorectal cancer patients.
21577013 2011 Progression-free survival in ovarian cancer is reflected in epigenetic DNA methylation profiles.
21533822 2011 Evaluation of guanylyl cyclase C lymph node status for colon cancer staging and prognosis.
21307149 2011 Occult tumor burden predicts disease recurrence in lymph node-negative colorectal cancer.
19895223 2009 GUCY2C reverse transcriptase PCR to stage pN0 colorectal cancer patients.
19694825 2009 Guanylyl cyclase C is a specific marker for differentiating primary and metastatic ovarian mucinous neoplasms.
19648115 2009 The linker region in receptor guanylyl cyclases is a key regulatory module: mutational analysis of guanylyl cyclase C.
19620276 2009 Cross talk between receptor guanylyl cyclase C and c-src tyrosine kinase regulates colon cancer cell cytostasis.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16899600 2006 A validated quantitative assay to detect occult micrometastases by reverse transcriptase-polymerase chain reaction of guanylyl cyclase C in patients with colorectal cancer.
16618413 2006 Bile acids induce ectopic expression of intestinal guanylyl cyclase C Through nuclear factor-kappaB and Cdx2 in human esophageal cells.
16541075 2006 The finished DNA sequence of human chromosome 12.
15825168 2005 Lack of guanylyl cyclase C, the receptor for Escherichia coli heat-stable enterotoxin, results in reduced polyp formation and increased apoptosis in the multiple intestinal neoplasia (Min) mouse model.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14748740 2004 Glycosylation of the receptor guanylate cyclase C: role in ligand binding and catalytic activity.
14581363 2003 The role of gelatinase in hepatic metastasis of colorectal cancer.
12649275 2003 Interaction of guanylyl cyclase C with SH3 domain of Src tyrosine kinase. Yet another mechanism for desensitization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444076 2002 Expression of the receptor guanylyl cyclase C and its ligands in reproductive tissues of the rat: a potential role for a novel signaling pathway in the epididymis.
12163327 2002 Ectopic expression of guanylyl cyclase C in adenocarcinomas of the esophagus and stomach.
11950846 2002 A novel PDZ protein regulates the activity of guanylyl cyclase C, the heat-stable enterotoxin receptor.
11889121 2002 Guanylin, uroguanylin, and heat-stable euterotoxin activate guanylate cyclase C and/or a pertussis toxin-sensitive G protein in human proximal tubule cells.
11478887 2001 Functional inactivation of the human guanylyl cyclase C receptor: modeling and mutation of the protein kinase-like domain.
11431160 2001 Uroguanylin and guanylate cyclase C in the human pancreas: expression and mutuality of ligand/receptor localization as indicators of intercellular paracrine signaling pathways.
11123935 2000 Biochemical characterization of the intracellular domain of the human guanylyl cyclase C receptor provides evidence for a catalytically active homotrimer.
11042348 2000 Evidence for the presence of cGMP-dependent protein kinase-II in human distal colon and in T84, the colonic cell line.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10601865 2000 Homologous desensitization of the human guanylate cyclase C receptor. Cell-specific regulation of catalytic activity.
8962140 1996 Guanylyl cyclase C is a selective marker for metastatic colorectal tumors in human extraintestinal tissues.
8661067 1996 Localization of the guanylyl cyclase C gene to mouse chromosome 6 and human chromosome 12p12.
8605253 1996 Cell line-specific transcriptional activation of the promoter of the human guanylyl cyclase C/heat-stable enterotoxin/receptor gene.
8381596 1993 Comparison of receptors for Escherichia coli heat-stable enterotoxin: novel receptor present in IEC-6 cells.
7761400 1995 Human steroidogenic acute regulatory protein: functional activity in COS-1 cells, tissue-specific expression, and mapping of the structural gene to 8p11.2 and a pseudogene to chromosome 13.
1718270 1991 Isolation and expression of a guanylate cyclase-coupled heat stable enterotoxin receptor cDNA from a human colonic cell line.
1680854 1991 Primary structure and functional expression of the human receptor for Escherichia coli heat-stable enterotoxin.