Property Summary

NCBI Gene PubMed Count 27
PubMed Score 28.56
PubTator Score 3.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Clostridium difficile colitis 12 3.316 1.7

Expression

  Differential Expression (26)

Disease log2 FC p
pancreatic cancer 1.400 7.7e-04
malignant mesothelioma -3.400 1.0e-08
astrocytoma -3.700 4.2e-04
posterior fossa group B ependymoma -3.300 1.3e-12
oligodendroglioma -2.000 4.5e-19
glioblastoma -3.400 3.1e-04
sonic hedgehog group medulloblastoma -3.000 6.9e-10
atypical teratoid / rhabdoid tumor -3.000 4.1e-08
medulloblastoma, large-cell -3.800 8.0e-06
primitive neuroectodermal tumor -3.000 2.6e-03
tuberculosis 1.100 1.3e-02
intraductal papillary-mucinous adenoma (... -2.900 2.1e-04
intraductal papillary-mucinous carcinoma... -2.700 7.4e-04
lung cancer -2.200 1.2e-05
colon cancer -1.800 6.8e-03
Parkinson's disease -1.100 3.1e-02
interstitial cystitis 2.100 3.7e-05
adult high grade glioma -2.900 2.6e-07
pilocytic astrocytoma -2.000 6.5e-09
primary Sjogren syndrome 1.100 2.0e-03
pancreatic carcinoma 1.400 7.7e-04
Pick disease -1.400 3.0e-03
gastric carcinoma 1.800 1.2e-02
acute myeloid leukemia -1.400 4.0e-02
ulcerative colitis 1.600 1.2e-03
ovarian cancer 2.000 1.2e-05

Gene RIF (12)

PMID Text
26876536 The kinetics of heme loss from oxidized sGC was monitored by a new method based on the heme group de-quenching the fluorescence of FlAsH-EDT2.
24733395 Dynamic interplay between hsp90, apo-sGC-beta1, and sGC-alpha1 in response to NO is unprecedented and represent new steps by which cells can modulate the heme content and activity of sGC for signaling cascades.
24666322 HIV-1 Tat potentiates NMDA-evoked (Ca2+)I responses involve LRP and a Src family kinase via the NOS/sGC/PKG pathway
23179318 Gene expression in dendritic cells of CCL5 and CXCL5 as well as TIMP1 and GUCY1B3 showed a significant increase within the first 4 days after trauma.
22690686 The G-protein regulator LGN modulates the activity of the NO receptor soluble guanylate cyclase
22426988 The results indicate that in comparison with the alpha-1 beta-1 isoform, the brain alpha-2 beta-1 isoform exhibits a distinctly different CO/NO affinity and binding rate in favor of NO signaling.
22223482 We concluded that the alpha-subunit and the beta(1)(191-619) domain exert structural strains on the heme domain.
21858179 Data show that show that it is possible to directly monitor the sGC haem oxidation state in intact cells. By inserting the TC motif into the coding sequence of the beta1 subunit of sGC in transiently transfected Chinese hamster ovary cells.
20105301 The mutant analysis indicated an importance for not only certain dimerization residue positions, but also an important role for other faces of the coiled coil dimer which might perhaps interact with adjacent domains
20063108 recombinant soluble guanylate cyclase (sGC) beta1 subunit and truncated N-terminal fragments expressed in E. coli; studied interaction between NO and sGC and schematic mechanism was proposed; study provides insights into structure and NO-binding of sGC
20024606 Results show that NOGCbeta1 and GC-A interact and that NOGCbeta1 regulates atrial natriuretic peptide signaling in HK-2 cells.
16528291 Although soluble guanylate cyclase(sGC) beta1-subunit expression was increased in mononuclear cells from patients with erectile dysfunction, the sGC activity was reduced

AA Sequence

MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMF      1 - 70
GKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSERE     71 - 140
GLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISP    141 - 210
YTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRS    211 - 280
KEGLLDVEKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATR    281 - 350
DLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNV    351 - 420
TILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCI    421 - 490
HHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKG    491 - 560
KINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFLSRKNTGTEETKQDDD               561 - 619
//

Text Mined References (30)

PMID Year Title
26876536 2016 The molecular mechanism of heme loss from oxidized soluble guanylate cyclase induced by conformational change.
24733395 2014 Nitric oxide and heat shock protein 90 activate soluble guanylate cyclase by driving rapid change in its subunit interactions and heme content.
24669844 2014 Interfacial residues promote an optimal alignment of the catalytic center in human soluble guanylate cyclase: heterodimerization is required but not sufficient for activity.
23505436 2013 Crystal structures of the catalytic domain of human soluble guanylate cyclase.
23179318 2013 Subsequent gene expression pattern in dendritic cells following multiple trauma.
22690686 2012 The G-protein regulator LGN modulates the activity of the NO receptor soluble guanylate cyclase.
22426988 2012 Structural and functional insights into the heme-binding domain of the human soluble guanylate cyclase ?2 subunit and heterodimeric ?2?1.
22223482 2012 Quaternary structure controls ligand dynamics in soluble guanylate cyclase.
21909115 2011 Genetic variants in novel pathways influence blood pressure and cardiovascular disease risk.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
21858179 2011 Fluorescence dequenching makes haem-free soluble guanylate cyclase detectable in living cells.
20105301 2010 Crystal structure of the signaling helix coiled-coil domain of the beta1 subunit of the soluble guanylyl cyclase.
20063108 2010 Efficient expression of human soluble guanylate cyclase in Escherichia coli and its signaling-related interaction with nitric oxide.
20024606 2010 Evidence for cross-talk between atrial natriuretic peptide and nitric oxide receptors.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16528291 Soluble guanylate cyclase beta1-subunit expression is increased in mononuclear cells from patients with erectile dysfunction.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15381706 2004 AGAP1, a novel binding partner of nitric oxide-sensitive guanylyl cyclase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12676772 2003 Novel complexes of guanylate cyclase with heat shock protein 90 and nitric oxide synthase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11572861 2001 Guanylyl cyclase/PSD-95 interaction: targeting of the nitric oxide-sensitive alpha2beta1 guanylyl cyclase to synaptic membranes.
10977868 2000 Guanylyl cyclases and signaling by cyclic GMP.
9742212 1998 Human soluble guanylate cyclase: functional expression and revised isoenzyme family.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8613461 1996 cGMP accumulation and gene expression of soluble guanylate cyclase in human vascular tissue.
8097486 1993 Colocalization of the genes coding for the alpha 3 and beta 3 subunits of soluble guanylyl cyclase to human chromosome 4 at q31.3-q33.
1680753 1991 Heterogeneity in human soluble guanylate cyclase due to alternative splicing.
1352257 1992 Molecular cloning of the cDNAs coding for the two subunits of soluble guanylyl cyclase from human brain.