Property Summary

NCBI Gene PubMed Count 29
PubMed Score 36.67
PubTator Score 12.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Essential Hypertension 82 0.0 2.0
Disease Target Count Z-score Confidence
Moyamoya disease 9 4.204 2.1
Achalasia 11 3.287 1.6
Disease Target Count
Moyamoya disease 6 with achalasia 1

Expression

  Differential Expression (27)

Disease log2 FC p
pancreatic cancer 1.200 2.6e-03
astrocytic glioma -2.200 3.9e-03
glioblastoma -2.000 1.9e-03
osteosarcoma 1.309 4.1e-02
posterior fossa group B ependymoma -2.300 4.8e-07
medulloblastoma -2.400 2.2e-05
atypical teratoid / rhabdoid tumor -2.600 1.1e-05
medulloblastoma, large-cell -2.400 2.7e-03
tuberculosis 1.100 1.4e-03
primary pancreatic ductal adenocarcinoma 1.115 4.0e-02
non-small cell lung cancer -1.203 1.6e-10
intraductal papillary-mucinous adenoma (... -3.400 7.6e-05
intraductal papillary-mucinous carcinoma... -3.400 1.3e-04
lung cancer -2.700 6.2e-06
colon cancer -2.100 2.0e-02
interstitial cystitis 1.700 2.6e-04
adult high grade glioma -2.000 5.7e-04
pilocytic astrocytoma -1.200 8.2e-03
pancreatic carcinoma 1.200 2.6e-03
breast carcinoma -1.200 1.6e-24
spina bifida -1.589 4.0e-02
Pick disease 1.200 4.1e-03
progressive supranuclear palsy 1.200 4.5e-02
Breast cancer -2.100 1.0e-05
gastric carcinoma 2.500 8.5e-03
ulcerative colitis 1.700 2.4e-03
ovarian cancer 1.200 3.1e-04

Protein-protein Interaction (6)

Gene RIF (14)

PMID Text
25373139 Expression of the alpha1-A680T sGC variant in reporter cells resulted in higher cyclic guanosine monophosphate production compared with the wild-type enzyme and the purified alpha1-A680T sGC exhibited enhanced sensitivity to nitric oxide in vitro.
24733395 Dynamic interplay between hsp90, apo-sGC-beta1, and sGC-alpha1 in response to NO is unprecedented and represent new steps by which cells can modulate the heme content and activity of sGC for signaling cascades.
24666322 HIV-1 Tat potentiates NMDA-evoked (Ca2+)I responses involve LRP and a Src family kinase via the NOS/sGC/PKG pathway
24581742 homozygous mutations in GUCY1A3, which encodes the alpha1 subunit of soluble guanylate cyclase, the major receptor for nitric oxide, might play a role in moyamoya and achalasia
24236047 ZNF280B upregulates GUCY1A3 expression and downregulates TP53 in prostate cancer cells.
22690686 The G-protein regulator LGN modulates the activity of the NO receptor soluble guanylate cyclase
22223482 We concluded that the alpha-subunit and the beta(1)(191-619) domain exert structural strains on the heme domain.
22174378 GCS-alpha-1 regulation of p53 activity is important in prostate cancer biology and may represent an important mechanism of p53 down-regulation.
21794866 analysis of pharmacological response to direct sGC activators in coronary artery disease patients
21725643 A novel insight into the heme and NO/CO binding mechanism of the alpha subunit of human soluble guanylate cyclase
21414799 NO, depending on its concentration, may act in human PBMCs as a stimulator of IL-6 expression and modulator of NF-KB involving the sGC/cGMP/PKG pathway
20964618 C-alpha1 sGC splice form is expressed at high levels in differentiating cells and its intracellular distribution varies from canonical alpha1 sGC subunit.
18550612 guanylate cyclase has a role in pulmonary arterial hypertension
15201957 Soluble guanylate cyclases could be the target molecules for controlling neo-vascularization in a subset of human malignant gliomas.

AA Sequence

MFCTKLKDLKITGECPFSLLAPGQVPNESSEEAAGSSESCKATVPICQDIPEKNIQESLPQRKTSRSRVY      1 - 70
LHTLAESICKLIFPEFERLNVALQRTLAKHKIKESRKSLEREDFEKTIAEQAVAAGVPVEVIKESLGEEV     71 - 140
FKICYEEDENILGVVGGTLKDFLNSFSTLLKQSSHCQEAGKRGRLEDASILCLDKEDDFLHVYYFFPKRT    141 - 210
TSLILPGIIKAAAHVLYETEVEVSLMPPCFHNDCSEFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTS    211 - 280
LFCKTFPFHFMFDKDMTILQFGNGIRRLMNRRDFQGKPNFEEYFEILTPKINQTFSGIMTMLNMQFVVRV    281 - 350
RRWDNSVKKSSRVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQAR    351 - 420
AQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNVTMLFSDIVGF    421 - 490
TAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHKESDTHAVQIALMALKMMELS    491 - 560
DEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLLKDCP    561 - 630
GFVFTPRSREELPPNFPSEIPGICHFLDAYQQGTNSKPCFQKKDVEDGNANFLGKASGID              631 - 690
//

Text Mined References (31)

PMID Year Title
25373139 2014 ?1-A680T variant in GUCY1A3 as a candidate conferring protection from pulmonary hypertension among Kyrgyz highlanders.
25249183 2015 Genome-wide association study in Chinese identifies novel loci for blood pressure and hypertension.
24733395 2014 Nitric oxide and heat shock protein 90 activate soluble guanylate cyclase by driving rapid change in its subunit interactions and heme content.
24669844 2014 Interfacial residues promote an optimal alignment of the catalytic center in human soluble guanylate cyclase: heterodimerization is required but not sufficient for activity.
24581742 2014 Loss of ?1?1 soluble guanylate cyclase, the major nitric oxide receptor, leads to moyamoya and achalasia.
24236047 2013 Zinc Finger 280B regulates sGC?1 and p53 in prostate cancer cells.
23505436 2013 Crystal structures of the catalytic domain of human soluble guanylate cyclase.
22751097 2012 Genome-wide association study in Han Chinese identifies four new susceptibility loci for coronary artery disease.
22690686 2012 The G-protein regulator LGN modulates the activity of the NO receptor soluble guanylate cyclase.
22223482 2012 Quaternary structure controls ligand dynamics in soluble guanylate cyclase.
22174378 2012 Soluble guanylyl cyclase ?1 and p53 cytoplasmic sequestration and down-regulation in prostate cancer.
21909115 2011 Genetic variants in novel pathways influence blood pressure and cardiovascular disease risk.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
21794866 2011 Measuring oxidative burden and predicting pharmacological response in coronary artery disease patients with a novel direct activator of haem-free/oxidised sGC.
21725643 2011 A novel insight into the heme and NO/CO binding mechanism of the alpha subunit of human soluble guanylate cyclase.
21414799 2011 Nitric oxide affects IL-6 expression in human peripheral blood mononuclear cells involving cGMP-dependent modulation of NF-?B activity.
20964618 2011 Nitric oxide receptor soluble guanylyl cyclase undergoes splicing regulation in differentiating human embryonic cells.
18550612 2008 Expression and function of soluble guanylate cyclase in pulmonary arterial hypertension.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15201957 2004 Inhibition of angiogenesis in human glioma cell lines by antisense RNA from the soluble guanylate cyclase genes, GUCY1A3 and GUCY1B3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107412 2002 Expressed sequence tag analysis of adult human iris for the NEIBank Project: steroid-response factors and similarities with retinal pigment epithelium.
10828587 2000 Assignment of GUCY1A3, a candidate gene for hypertension, to human chromosome bands 4q31.1-->q31.2 by in situ hybridization.
10717483 2000 A novel Pax-6 binding site in rodent B1 repetitive elements: coevolution between developmental regulation and repeated elements?
9742212 1998 Human soluble guanylate cyclase: functional expression and revised isoenzyme family.
8613461 1996 cGMP accumulation and gene expression of soluble guanylate cyclase in human vascular tissue.
8097486 1993 Colocalization of the genes coding for the alpha 3 and beta 3 subunits of soluble guanylyl cyclase to human chromosome 4 at q31.3-q33.
1352257 1992 Molecular cloning of the cDNAs coding for the two subunits of soluble guanylyl cyclase from human brain.