Property Summary

Ligand Count 5
NCBI Gene PubMed Count 33
PubMed Score 37.97
PubTator Score 12.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Essential Hypertension 94 0.0 3.0
Disease Target Count Z-score Confidence
Moyamoya disease 10 4.049 2.0
Achalasia 13 3.165 1.6

Expression

  Differential Expression (27)

Disease log2 FC p
adult high grade glioma -2.000 5.7e-04
astrocytic glioma -1.200 4.3e-03
Astrocytoma, Pilocytic -1.200 5.8e-03
atypical teratoid / rhabdoid tumor -2.600 1.1e-05
Breast cancer -2.100 1.0e-05
breast carcinoma -1.200 1.6e-24
colon cancer -2.100 2.0e-02
ependymoma -1.500 6.0e-07
gastric carcinoma 2.400 1.2e-02
glioblastoma -1.500 1.8e-04
group 3 medulloblastoma -1.700 1.9e-02
interstitial cystitis 1.200 1.5e-02
intraductal papillary-mucinous adenoma (... -3.400 7.6e-05
intraductal papillary-mucinous carcinoma... -3.400 1.3e-04
lung cancer -1.900 3.8e-03
medulloblastoma, large-cell -2.400 2.7e-03
non-small cell lung cancer -1.203 1.6e-10
osteosarcoma 1.309 4.1e-02
ovarian cancer 1.200 3.1e-04
pancreatic cancer 1.200 2.6e-03
pancreatic carcinoma 1.200 2.6e-03
Pick disease 1.200 4.1e-03
primary pancreatic ductal adenocarcinoma 1.115 4.0e-02
progressive supranuclear palsy 1.200 4.5e-02
spina bifida -1.580 3.8e-02
tuberculosis 1.100 1.4e-03
ulcerative colitis 1.400 1.5e-02

Protein-protein Interaction (2)

Gene RIF (18)

AA Sequence

MFCTKLKDLKITGECPFSLLAPGQVPNESSEEAAGSSESCKATVPICQDIPEKNIQESLPQRKTSRSRVY      1 - 70
LHTLAESICKLIFPEFERLNVALQRTLAKHKIKESRKSLEREDFEKTIAEQAVAAGVPVEVIKESLGEEV     71 - 140
FKICYEEDENILGVVGGTLKDFLNSFSTLLKQSSHCQEAGKRGRLEDASILCLDKEDDFLHVYYFFPKRT    141 - 210
TSLILPGIIKAAAHVLYETEVEVSLMPPCFHNDCSEFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTS    211 - 280
LFCKTFPFHFMFDKDMTILQFGNGIRRLMNRRDFQGKPNFEEYFEILTPKINQTFSGIMTMLNMQFVVRV    281 - 350
RRWDNSVKKSSRVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQAR    351 - 420
AQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNVTMLFSDIVGF    421 - 490
TAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHKESDTHAVQIALMALKMMELS    491 - 560
DEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLLKDCP    561 - 630
GFVFTPRSREELPPNFPSEIPGICHFLDAYQQGTNSKPCFQKKDVEDGNANFLGKASGID              631 - 690
//

Text Mined References (35)

PMID Year Title