Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.14
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -3.054 6.9e-08
chronic lymphosyte leukemia -1.500 5.8e-09
pancreatic ductal adenocarcinoma liver m... -1.919 2.4e-03
non primary Sjogren syndrome sicca 1.300 2.3e-02
ovarian cancer 2.000 2.1e-05

Gene RIF (1)

PMID Text
24743017 The expression and function of a ubiquitous protein, GUCD1, were characterized, it might have a role in regulating normal and abnormal cell growth in the liver.

AA Sequence

MRTEAEAAGPPLEPGDFVQLPVPVIQQLYHWDCGLACSRMVLRYLGQLDDSEFERALQKLQLTRSIWTID      1 - 70
LAYLMHHFGVRHRFCTQTLGVDKGYKNQSFYRKHFDTEETRVNQLFAQAKACKVLVEKCTVSVKDIQAHL     71 - 140
AQGHVAIVLVNSGVLHCDLCSSPVKYCCFTPSGHHCFCRTPDYQGHFIVLRGYNRATGCIFYNNPAYADP    141 - 210
GMCSTSISNFEEARTSYGTDEDILFVYLDS                                            211 - 240
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24743017 2014 NEDD4 controls the expression of GUCD1, a protein upregulated in proliferating liver cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.