Property Summary

NCBI Gene PubMed Count 26
PubMed Score 25.71
PubTator Score 12.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Gene RIF (10)

PMID Text
26209226 Study identifies GTSE1 as a biomarker for cisplatin resistance in gastric cancer cells and suggests its repressive role in cisplatin induced apoptosis making it a potential therapeutic target for better clinical management of gastric cancer patients.
23236459 GTSE1 is a microtubule plus-end tracking protein that regulates EB1-dependent cell migration.
22292647 GTSE1 is overexpressed dramatically in lung cancer patients' tissues.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20577264 Data show that G2 and S-phase-expressed 1 (GTSE1) protein, a negative regulator of p53, is required for G2 checkpoint recovery and that Plk1 phosphorylation of GTSE1 promotes its nuclear localization.
20018861 hGTSE-1 mediated-p21(CIP1/WAF1) stabilization is clearly involved in the ability of cells to counteract cytotoxicity induced by the microtubule poison paclitaxel.
19913121 Observational study of gene-disease association. (HuGE Navigator)
14707141 requires an intact nuclear export signal and functional Mdm2 for the regulation of p53
12750368 GTSE-1 controls DNA damage-induced apoptosis by affecting p53 function

AA Sequence

MDDPKKEDILLLADEKFDFDLSLSSSSANEDDEVFFGPFGHKERCIAASLELNNPVPEQPPLPTSESPFA      1 - 70
WSPLAGEKFVEVYKEAHLLALHIESSSRNQAAQAAKPEDPRSQGVERFIQESKLKINLFEKEKEMKKSPT     71 - 140
SLKRETYYLSDSPLLGPPVGEPRLLASSPALPSSGAQARLTRAPGPPHSAHALPRESCTAHAASQAATQR    141 - 210
KPGTKLLLPRAASVRGRSIPGAAEKPKKEIPASPSRTKIPAEKESHRDVLPDKPAPGAVNVPAAGSHLGQ    211 - 280
GKRAIPVPNKLGLKKTLLKAPGSTSNLARKSSSGPVWSGASSACTSPAVGKAKSSEFASIPANSSRPLSN    281 - 350
ISKSGRMGPAMLRPALPAGPVGASSWQAKRVDVSELAAEQLTAPPSASPTQPQTPEGGGQWLNSSCAWSE    351 - 420
SSQLNKTRSIRRRDSCLNSKTKVMPTPTNQFKIPKFSIGDSPDSSTPKLSRAQRPQSCTSVGRVTVHSTP    421 - 490
VRRSSGPAPQSLLSAWRVSALPTPASRRCSGLPPMTPKTMPRAVGSPLCVPARRRSSEPRKNSAMRTEPT    491 - 560
RESNRKTDSRLVDVSPDRGSPPSRVPQALNFSPEESDSTFSKSTATEVAREEAKPGGDAAPSEALLVDIK    561 - 630
LEPLAVTPDAASQPLIDLPLIDFCDTPEAHVAVGSESRPLIDLMTNTPDMNKNVAKPSPVVGQLIDLSSP    631 - 700
LIQLSPEADKENVDSPLLKF                                                      701 - 720
//

Text Mined References (33)

PMID Year Title
26209226 2015 GTSE1 expression represses apoptotic signaling and confers cisplatin resistance in gastric cancer cells.
23236459 2012 GTSE1 is a microtubule plus-end tracking protein that regulates EB1-dependent cell migration.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22292647 2011 Up-regulation of GTSE1 lacks a relationship with clinical data in lung cancer.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20577264 2010 Polo-like kinase 1 phosphorylation of G2 and S-phase-expressed 1 protein is essential for p53 inactivation during G2 checkpoint recovery.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20018861 2010 Human GTSE-1 regulates p21(CIP1/WAF1) stability conferring resistance to paclitaxel treatment.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15998911 2005 Examples of the complex architecture of the human transcriptome revealed by RACE and high-density tiling arrays.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14707141 2004 hGTSE-1 expression stimulates cytoplasmic localization of p53.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12750368 2003 The cell cycle-regulated protein human GTSE-1 controls DNA damage-induced apoptosis by affecting p53 function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10984615 2000 Cell-cycle regulation of the p53-inducible gene B99.
10974554 2000 Cloning, chromosome mapping and functional characterization of a human homologue of murine gtse-1 (B99) gene.
10591208 1999 The DNA sequence of human chromosome 22.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.