Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.9e-06

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.200 1.9e-06

Gene RIF (2)

AA Sequence

MAAPGLRLGAGRLFEMPAVLERLSRYNSTSQAFAEVLRLPKQQLRKLLYPLQEVERFLAPYGRQDLHLRI      1 - 70
FDPSPEDIARADNIFTATERNRIDYVSSAVRIDHAPDLPRPEVCFIGRSNVGKSSLIKALFSLAPEVEVR     71 - 140
VSKKPGHTKKMNFFKVGKHFTVVDMPGYGFRAPEDFVDMVETYLKERRNLKRTFLLVDSVVGIQKTDNIA    141 - 210
IEMCEEFALPYVIVLTKIDKSSKGHLLKQVLQIQKFVNMKTQGCFPQLFPVSAVTFSGIHLLRCFIASVT    211 - 280
GSLD                                                                      281 - 284
//

Text Mined References (7)

PMID Year Title