Property Summary

NCBI Gene PubMed Count 4
PubMed Score 13.10
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8297 5.0e-07
malignant mesothelioma 3135 2.1e-05
psoriasis 6514 1.3e-04
group 4 medulloblastoma 1806 4.1e-04
Disease Target Count Z-score Confidence
Rabies 18 3.254 1.6
Klinefelter's syndrome 55 3.234 1.6

AA Sequence

MWALRAAVRPGLRLSRVGRGRSAPRAAAPSCPARALAAVGRRSPGNLEGPWGGGRGLRADGGRSRTGDDE      1 - 70
EEPEDADENAEEELLRGEPLLPAGTQRVCLVHPDVKWGPGKSQMTRAEWQVAEATALVHTLDGWSVVQTM     71 - 140
VVSTKTPDRKLIFGKGNFEHLTEKIRGSPDVTCVFLNVERMAAPTKKELEAAWGVEVFDRFTVVLHIFRC    141 - 210
NARTKEARLQVALAEMPLHRSNLKRDVAHLYRGVGSRYIMGSGESFMQLQQRLLREKEAKIRKALDRLRK    211 - 280
KRHLLRRQRTRREFPVISVVGYTNCGKTTLIKALTGDAAIQPRDQLFATLDVTAHAGTLPSRMTVLYVDT    281 - 350
IGFLSQLPHGLIESFSATLEDVAHSDLILHVRDVSHPEAELQKCSVLSTLRGLQLPAPLLDSMVEVHNKV    351 - 420
DLVPGYSPTEPNVVPVSALRGHGLQELKAELDAAVLKATGRQILTLRVRLAGAQLSWLYKEATVQEVDVI    421 - 490
PEDGAADVRVIISNSAYGKFRKLFPG                                                491 - 516
//

Text Mined References (6)

PMID Year Title