Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.73
PubTator Score 1.00

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
osteosarcoma 7766 1.8e-07
medulloblastoma, large-cell 6086 7.7e-05
group 3 medulloblastoma 4002 3.1e-04
ovarian cancer 8297 4.0e-04
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7


  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.300 3.1e-04
medulloblastoma, large-cell 1.200 7.7e-05
osteosarcoma -1.815 1.8e-07
ovarian cancer 1.400 4.0e-04

Gene RIF (1)

AA Sequence

NDALHKKQLLNLWISDTMSSTEPPSKHAVTTSKMDII                                     351 - 387

Text Mined References (14)

PMID Year Title