Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.36
PubTator Score 0.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.4e-80
Disease Target Count Z-score Confidence
Contagious pustular dermatitis 11 5.699 2.8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 3.4e-80

AA Sequence

MAAAADERSPEDGEDEEEEEQLVLVELSGIIDSDFLSKCENKCKVLGIDTERPILQVDSCVFAGEYEDTL      1 - 70
GTCVIFEENVEHADTEGNNKTVLKYKCHTMKKLSMTRTLLTEKKEGEENIGGVEWLQIKDNDFSYRPNMI     71 - 140
CNFLHENEDEEVVASAPDKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQ    141 - 210
MLP                                                                       211 - 213
//

Text Mined References (6)

PMID Year Title