Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.58
PubTator Score 2.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.039 1.6e-06
group 3 medulloblastoma 1.200 1.2e-02
intraductal papillary-mucinous adenoma (... 1.200 3.5e-03
intraductal papillary-mucinous carcinoma... 1.300 3.3e-03
lung cancer 1.900 3.6e-05
medulloblastoma, large-cell 1.400 2.3e-04
osteosarcoma 1.158 2.7e-02
ovarian cancer 1.500 7.8e-05
Pick disease 1.300 2.6e-04
psoriasis 1.100 1.4e-03

 GO Function (1)

Gene RIF (3)

AA Sequence

MSGFSPELIDYLEGKISFEEFERRREERKTREKKSLQEKGKLSAEENPDDSEVPSSSGINSTKSQDKDVN      1 - 70
EGETSDGVRKSVHKVFASMLGENEDDEEEEEEEEEEEEEEETPEQPTAGDVFVLEMVLNRETKKMMKEKR     71 - 140
PRSKLPRALRGLMGEANIRFARGEREEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAA    141 - 210
HLNPSDTEEWVRLAEMSLEQDNIKQAIFCYTKALKYEPTNVRYLWERSSLYEQMGDHKMAMDGYRRILNL    211 - 280
LSPSDGERFMQLARDMAKSYYEANDVTSAINIIDEAFSKHQGLVSMEDVNIAAELYISNKQYDKALEIIT    281 - 350
DFSGIVLEKKTSEEGTSEENKAPENVTCTIPDGVPIDITVKLMVCLVHLNILEPLNPLLTTLVEQNPEDM    351 - 420
GDLYLDVAEAFLDVGEYNSALPLLSALVCSERYNLAVVWLRHAECLKALGYMERAAESYGKVVDLAPLHL    421 - 490
DARISLSTLQQQLGQPEKALEALEPMYDPDTLAQDANAAQQELKLLLHRSTLLFSQGKMYGYVDTLLTML    491 - 560
AMLLKVAMNRAQVCLISSSKSGERHLYLIKVSRDKISDSNDQESANCDAKAIFAVLTSVLTKDDWWNLLL    561 - 630
KAIYSLCDLSRFQEAELLVDSSLEYYSFYDDRQKRKELEYFGLSAAILDKNFRKAYNYIRIMVMENVNKP    631 - 700
QLWNIFNQVTMHSQDVRHHRFCLRLMLKNPENHALCVLNGHNAFVSGSFKHALGQYVQAFRTHPDEPLYS    701 - 770
FCIGLTFIHMASQKYVLRRHALIVQGFSFLNRYLSLRGPCQESFYNLGRGLHQLGLIHLAIHYYQKALEL    771 - 840
PPLVVEGIELDQLDLRRDIAYNLSLIYQSSGNTGMAQTLLYTYCSI                            841 - 886
//

Text Mined References (22)

PMID Year Title