Property Summary

NCBI Gene PubMed Count 88
PubMed Score 108.96
PubTator Score 87.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 2.000 1.6e-02
ependymoma 2.700 9.5e-04
oligodendroglioma 2.800 5.8e-04
psoriasis 1.100 3.1e-04
osteosarcoma 2.014 6.8e-05
group 4 medulloblastoma 2.700 3.0e-06
atypical teratoid / rhabdoid tumor 2.100 2.2e-05
glioblastoma 1.700 5.7e-03
medulloblastoma, large-cell 2.700 1.9e-05
primitive neuroectodermal tumor 1.100 2.1e-04
pediatric high grade glioma 1.200 1.1e-02
aldosterone-producing adenoma -1.466 4.2e-02
Gaucher disease type 1 -1.500 1.2e-02

 GWAS Trait (1)

Gene RIF (42)

PMID Text
26814176 The authors found that human adenovirus 5 infection or ectopic E4-ORF3 expression leads to SUMOylation of TFII-I that precedes a rapid decline in TFII-I protein levels.
26656605 A novel interaction between TFII-I and Mdm2 with a negative effect on TFII-I transcriptional activity has been documented.
26320362 Study demonstrates a significant association between SLE in Chinese Han population and the GTF2I rs117026326 T allele/GTF2IRD1 rs4717901 C allele.
26285132 Copy-number variation in the general transcription factor gene, GTF2I is associated with gene-dose-dependent anxiety in mouse models and in both Williams syndrome and Dup7.
25926634 Rather than contributing positively to promoter activity, a putative initiator element at the transcription start site acts as a target for negative regulation imposed on the L4P promoter of human adenovirus Type 5 by cellular TFII-I.
25869096 show that SUMOylation is critical for TFII-I to promote cell proliferation and colony formation. Our findings contribute to understanding the role of SUMOylation in liver cancer development
25501393 A proportion of this transcriptional dysregulation is caused by dosage imbalances in GTF2I, which encodes a key transcription factor at 7q11.23 that is associated with the LSD1 repressive chromatin complex and silences its dosage-sensitive targets.
25480810 The GTF2I rs117026326 polymorphism is associated with anti-SSA-positive primary Sjogren's syndrome.
25429715 Findings implicate the GTF2I gene in the neurogenetic basis of social communication and social anxiety, both in Williams syndrome and among individuals in healthy populations
24974848 GTF2I mutation correlated with better survival.
24922507 TFII-I bridges Proliferating Cell Nuclear Antigen and Polzeta to promote Translesion synthesis
24231951 Results reveal novel mechanisms by which TFII-I and DBC1 can modulate cellular fate by affecting cell-cycle control as well as the homologous recombination pathway.
22608712 CLIP2 haploinsufficiency by itself does not lead to the physical or cognitive characteristics of the Williams-Beuren syndrome; GTF2IRD1 and GTF2I are the main genes causing the cognitive defects
22578324 GTF2I duplication results in separation anxiety in mice and humans
22566418 TFII-I gene deletion may explain the Williams-Beuren syndrome phenotype because it acts as a negative regulator of TRPC3 expression in human B lymphocytes.
22048961 Our findings suggest the GTF2i gene is important in the etiology of autism in individuals with this duplication and in non-duplication cases with severe social interaction problems and repetitive behaviors.
21813151 These data indicate that an E-box motif (RBE1) within the core promoter in the long terminal repeat of HIV-1 is a bona fide binding site for the RBF-2 transcription factor complex USF1, USF2, and TFII-I.
21613400 Inhibition of SREBP2 activity reduces TFII-I induction in response to HIV-1 infection or activation of human primary CD4(+) T cells and TFII-I contributes to Tat-dependent viral gene expression
21549311 Data show that Igh 3' enhancer-bound OCA-B and promoter-bound TFII-I mediate promoter-enhancer interactions, in both cis and trans, that are important for Igh transcription.
21503958 Data demonstrate that not only does cell surface GRP78 regulate apoptosis, but it also regulates Ca(2+) homeostasis by controlling cell surface localization of TFII-I.
21407215 TFII-I may modulate the cellular functions of BRCA1.
21328569 These data indicate that Gtf2i is involved in several aspects of embryonic development and the development of social neurocircuitry and that GTF2I haploinsufficiency could be a contributor to the hypersociability in WBS patients.
19897463 functional hemizygosity for the GTF2I and GTF2IRD1 genes is the main cause of the neurocognitive profile and some aspects of the gestalt phenotype of Williams-Beuren syndrome
19880526 TFII-I plays an inhibitory role in regulating genes that are essential in osteogenesis and intersects with the bone-specific transcription factor Runx2 and the retinoblastoma protein, pRb.
19701889 these results provide an initial step in understanding the biological role of Itk-TFII-I signaling in T-cell function.
19182516 Results suggest that TFII-I appears to have distinct roles in distinct phases of the mammalian cell cycle.
19111598 analyzed promoter regions of TFII-I genes and described their additional exons, as well as tested tissue specificity of both previously reported and novel alternatively spliced isoforms
19097122 alpha(2)-macroglobulin induced increase in GRP78 synthesis is caused by transcriptional upregulation of TFII-I
18976654 These results demonstrate an essential role of TFII-I bound at an upstream LTR element for viral replication.
18579769 Bioinformatics and microarray results were combined to identify TFII-I downstream targets in the vertebrate genome.
18445785 TFII-I, PARP1, and SFPQ proteins, each previously implicated in gene regulation, form a complex controlling transcription of DYX1C1. Allelic differences in the promoter or 5'UTR of DYX1C1 may affect factor binding and thus regulation of the gene.
17023658 observations suggest a model in which TFII-I suppresses agonist-induced calcium entry by competing with TRPC3 for binding to phospholipase C-gamma
16943425 The data suggest that TFII-I and USF regulate chromatin structure accessibility and recruitment of transcription complexes in the beta-globin gene locus.
16738337 TFII-I directly interacts with Bright through amino acids in Bright's protein interaction domain
16314517 TFII-I is recruited to the cyclin D1 promoter and transcriptionally activates this gene.
16166082 cGMP-dependent protein kinase Ibeta binds to TFII-I and IRAG through a common interaction motif
15941713 human VEGFR-2 promoter is functionally counter-regulated by TFII-I and TFII-IRD1.
15767439 These results demonstrate that USF1/USF2 and TFII-I interact cooperatively at the upstream RBEIII element and are necessary for the induction of latent HIV-1 in response to T-cell activation signals.
15664986 TFII-I is required for optimal induction of Grp78 by ER stress
14556246 Comparison of these five families with reports of other individuals with partial deletions of the WS region most strongly implicates GTF2I in the mental retardation of WS.
12865760 GTF2IRD1 and GTF2I have roles in causing deficits on visual spatial functioning
12082086 G-kinase I beta interacted specifically with TFII-I, an unusual transcriptional regulator that associates with multiple proteins to modulate both basal and signal-induced transcription

AA Sequence

MAQVAMSTLPVEDEESSESRMVVTFLMSALESMCKELAKSKAEVACIAVYETDVFVVGTERGRAFVNTRK      1 - 70
DFQKDFVKYCVEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKTVEDYFCFCYGKALGKSTVVPVPYEK     71 - 140
MLRDQSAVVVQGLPEGVAFKHPENYDLATLKWILENKAGISFIIKRPFLEPKKHVGGRVMVTDADRSILS    141 - 210
PGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQAGPSETDDVDEKQPLSKPLQGSHHSS    211 - 280
EGNEGTEMEVPAEDSTQHVPSETSEDPEVEVTIEDDDYSPPSKRPKANELPQPPVPEPANAGKRKVREFN    281 - 350
FEKWNARITDLRKQVEELFERKYAQAIKAKGPVTIPYPLFQSHVEDLYVEGLPEGIPFRRPSTYGIPRLE    351 - 420
RILLAKERIRFVIKKHELLNSTREDLQLDKPASGVKEEWYARITKLRKMVDQLFCKKFAEALGSTEAKAV    421 - 490
PYQKFEAHPNDLYVEGLPENIPFRSPSWYGIPRLEKIIQVGNRIKFVIKRPELLTHSTTEVTQPRTNTPV    491 - 560
KEDWNVRITKLRKQVEEIFNLKFAQALGLTEAVKVPYPVFESNPEFLYVEGLPEGIPFRSPTWFGIPRLE    561 - 630
RIVRGSNKIKFVVKKPELVISYLPPGMASKINTKALQSPKRPRSPGSNSKVPEIEVTVEGPNNNNPQTSA    631 - 700
VRTPTQTNGSNVPFKPRGREFSFEAWNAKITDLKQKVENLFNEKCGEALGLKQAVKVPFALFESFPEDFY    701 - 770
VEGLPEGVPFRRPSTFGIPRLEKILRNKAKIKFIIKKPEMFETAIKESTSSKSPPRKINSSPNVNTTASG    771 - 840
VEDLNIIQVTIPDDDNERLSKVEKARQLREQVNDLFSRKFGEAIGMGFPVKVPYRKITINPGCVVVDGMP    841 - 910
PGVSFKAPSYLEISSMRRILDSAEFIKFTVIRPFPGLVINNQLVDQSESEGPVIQESAEPSQLEVPATEE    911 - 980
IKETDGSSQIKQEPDPTW                                                        981 - 998
//

Text Mined References (105)

PMID Year Title
26814176 2016 The Adenovirus E4-ORF3 Protein Stimulates SUMOylation of General Transcription Factor TFII-I to Direct Proteasomal Degradation.
26656605 2015 A Novel Interaction between TFII-I and Mdm2 with a Negative Effect on TFII-I Transcriptional Activity.
26320362 Association of GTF2I and GTF2IRD1 polymorphisms with systemic lupus erythematosus in a Chinese Han population.
26285132 2015 Variation in the Williams syndrome GTF2I gene and anxiety proneness interactively affect prefrontal cortical response to aversive stimuli.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25926634 2015 The Human Adenovirus Type 5 L4 Promoter Is Negatively Regulated by TFII-I and L4-33K.
25869096 2015 Functional Proteomics Study Reveals SUMOylation of TFII-I is Involved in Liver Cancer Cell Proliferation.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25646466 2015 Genome-wide targeting of the epigenetic regulatory protein CTCF to gene promoters by the transcription factor TFII-I.
25501393 2015 7q11.23 dosage-dependent dysregulation in human pluripotent stem cells affects transcriptional programs in disease-relevant lineages.
25480810 2015 The GTF2I rs117026326 polymorphism is associated with anti-SSA-positive primary Sjögren's syndrome.
25429715 2014 Cognitive-behavioral phenotypes of Williams syndrome are associated with genetic variation in the GTF2I gene, in a healthy population.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24974848 2014 A specific missense mutation in GTF2I occurs at high frequency in thymic epithelial tumors.
24922507 2014 The transcription factor TFII-I promotes DNA translesion synthesis and genomic stability.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24231951 2013 Role of multifunctional transcription factor TFII-I and putative tumour suppressor DBC1 in cell cycle and DNA double strand damage repair.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24097066 2013 A genome-wide association study in Han Chinese identifies a susceptibility locus for primary Sjögren's syndrome at 7q11.23.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22608712 2012 The contribution of CLIP2 haploinsufficiency to the clinical manifestations of the Williams-Beuren syndrome.
22578324 2012 Duplication of GTF2I results in separation anxiety in mice and humans.
22566418 2012 Williams-Beuren syndrome hypercalcemia: is TRPC3 a novel mediator in calcium homeostasis?
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22048961 2012 Association of GTF2i in the Williams-Beuren syndrome critical region with autism spectrum disorders.
22037610 2012 Biochemistry and biology of the inducible multifunctional transcription factor TFII-I: 10 years later.
21813151 2011 Identification and functional analysis of a second RBF-2 binding site within the HIV-1 promoter.
21549311 2011 Direct interactions of OCA-B and TFII-I regulate immunoglobulin heavy-chain gene transcription by facilitating enhancer-promoter communication.
21503958 2011 Loss of cell surface TFII-I promotes apoptosis in prostate cancer cells stimulated with activated ?? -macroglobulin.
21407215 2011 Multifunctional transcription factor TFII-I is an activator of BRCA1 function.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21328569 2011 Haploinsufficiency of Gtf2i, a gene deleted in Williams Syndrome, leads to increases in social interactions.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19897463 2010 Partial 7q11.23 deletions further implicate GTF2I and GTF2IRD1 as the main genes responsible for the Williams-Beuren syndrome neurocognitive profile.
19880526 2009 Williams-Beuren syndrome-associated transcription factor TFII-I regulates osteogenic marker genes.
19701889 2009 Characterization of a novel interaction between transcription factor TFII-I and the inducible tyrosine kinase in T cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19282872 2009 William's syndrome: gene expression is related to parental origin and regional coordinate control.
19242469 2009 A mechanosensitive transcriptional mechanism that controls angiogenesis.
19214191 2009 Signalling of the BCR is regulated by a lipid rafts-localised transcription factor, Bright.
19205026 2009 Is it Williams syndrome? GTF2IRD1 implicated in visual-spatial construction and GTF2I in sociability revealed by high resolution arrays.
19182516 2009 Phase specific functions of the transcription factor TFII-I during cell cycle.
19111598 2009 Alternative splicing and promoter use in TFII-I genes.
19097122 2009 Transcription factor TFII-I causes transcriptional upregulation of GRP78 synthesis in prostate cancer cells.
18976654 2008 Specific interaction of TFII-I with an upstream element on the HIV-1 LTR regulates induction of latent provirus.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18579769 2008 Identification of the TFII-I family target genes in the vertebrate genome.
18445785 2008 The complex of TFII-I, PARP1, and SFPQ proteins regulates the DYX1C1 gene implicated in neuronal migration and dyslexia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17023658 2006 Action of TFII-I outside the nucleus as an inhibitor of agonist-induced calcium entry.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16943425 2006 Antagonistic regulation of beta-globin gene expression by helix-loop-helix proteins USF and TFII-I.
16738337 2006 Induction of immunoglobulin heavy-chain transcription through the transcription factor Bright requires TFII-I.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16314517 2005 Inhibition of TFII-I-dependent cell cycle regulation by p53.
16166082 2005 Identification of the interface between cGMP-dependent protein kinase Ibeta and its interaction partners TFII-I and IRAG reveals a common interaction motif.
16055724 2005 Positive and negative regulation of the transforming growth factor beta/activin target gene goosecoid by the TFII-I family of transcription factors.
15941713 2005 Vascular endothelial growth factor receptor-2: counter-regulation by the transcription factors, TFII-I and TFII-IRD1.
15767439 2005 TFII-I regulates induction of chromosomally integrated human immunodeficiency virus type 1 long terminal repeat in cooperation with USF.
15664986 2005 Transcriptional regulation of the Grp78 promoter by endoplasmic reticulum stress: role of TFII-I and its tyrosine phosphorylation.
15635413 2005 Nucleolar proteome dynamics.
15561718 2005 Systematic identification and analysis of mammalian small ubiquitin-like modifier substrates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231747 2004 A protein interaction framework for human mRNA degradation.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14623887 2004 Mechanism of Bruton's tyrosine kinase-mediated recruitment and regulation of TFII-I.
14556246 2003 GTF2I hemizygosity implicated in mental retardation in Williams syndrome: genotype-phenotype analysis of five families with deletions in the Williams syndrome region.
12865760 Williams syndrome deficits in visual spatial processing linked to GTF2IRD1 and GTF2I on chromosome 7q11.23.
12853948 2003 The DNA sequence of human chromosome 7.
12493763 2003 A candidate X-linked mental retardation gene is a component of a new family of histone deacetylase-containing complexes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393887 2003 Histone deacetylase 3 binds to and regulates the multifunctional transcription factor TFII-I.
12239342 2002 Physical and functional interactions of histone deacetylase 3 with TFII-I family proteins and PIASxbeta.
12193603 2002 The SUMO ubiquitin-protein isopeptide ligase family member Miz1/PIASxbeta /Siz2 is a transcriptional cofactor for TFII-I.
12082086 2002 cGMP-dependent protein kinase I beta physically and functionally interacts with the transcriptional regulator TFII-I.
11934902 2002 c-Src-dependent transcriptional activation of TFII-I.
11373296 2001 Identification of phosphorylation sites for Bruton's tyrosine kinase within the transcriptional regulator BAP/TFII-I.
11313464 2001 JAK2 activates TFII-I and regulates its interaction with extracellular signal-regulated kinase.
11287625 2001 Identification of TFII-I as the endoplasmic reticulum stress response element binding factor ERSF: its autoregulation by stress and interaction with ATF6.
10854432 2000 Alternatively spliced isoforms of TFII-I. Complex formation, nuclear translocation, and differential gene regulation.
10648599 2000 Extracellular signal-regulated kinase binds to TFII-I and regulates its activation of the c-fos promoter.
10373551 1999 Regulation of nuclear localization and transcriptional activity of TFII-I by Bruton's tyrosine kinase.
9837922 1998 Regulation of TFII-I activity by phosphorylation.
9671454 1998 TFII-I regulates Vbeta promoter activity through an initiator element.
9584171 1998 TFII-I enhances activation of the c-fos promoter through interactions with upstream elements.
9466987 1998 A duplicated gene in the breakpoint regions of the 7q11.23 Williams-Beuren syndrome deletion encodes the initiator binding protein TFII-I and BAP-135, a phosphorylation target of BTK.
9384587 1997 Cloning of an inr- and E-box-binding protein, TFII-I, that interacts physically and functionally with USF1.
9334314 1997 A multifunctional DNA-binding protein that promotes the formation of serum response factor/homeodomain complexes: identity to TFII-I.
9012831 1997 BAP-135, a target for Bruton's tyrosine kinase in response to B cell receptor engagement.
8377829 1993 Direct role for Myc in transcription initiation mediated by interactions with TFII-I.
1961251 1991 Cooperative interaction of an initiator-binding transcription initiation factor and the helix-loop-helix activator USF.