Property Summary

NCBI Gene PubMed Count 18
PubMed Score 36.43
PubTator Score 43.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma 1.411 1.2e-03
glioblastoma -2.000 1.6e-04
atypical teratoid / rhabdoid tumor -1.600 2.3e-05
medulloblastoma, large-cell -1.800 4.9e-06
lung cancer 1.500 3.2e-02
pediatric high grade glioma -1.600 6.5e-05
pilocytic astrocytoma -1.100 8.0e-04
Polycystic Ovary Syndrome 1.155 3.2e-02
acute myeloid leukemia -1.300 3.5e-02
ovarian cancer 2.100 5.1e-06
pituitary cancer 1.200 5.4e-04

 GO Function (1)

 MGI Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (10)

Gene RIF (8)

PMID Text
26463438 Low levels of GTF2H5 are associated with enhanced prognosis in high-grade serous ovarian cancer patients and may contribute to cisplatin sensitization.
25620205 Transcriptional differences found between various TFIIH subunit variants participate in the phenotypic variability observed among xeroderma pigmentosum, XP associated with Cockayne syndrome, and trichothiodystrophy individuals.
23729738 Findings give new insights into the behavior of TTDA within the context of a living cell and thereby shed light on the complex phenotype of TTD-A patients.
20522537 Observational study of gene-disease association. (HuGE Navigator)
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17350038 The solution structure of the p8/TTD-A protein, a small alpha/beta protein built around an antiparallel beta-sheet that forms a homodimer with an extended interface, is reported.
16669699 TTDA is the first Transcription Factor IIH subunit with a primarily nucleotide excision repair-dedicated role in vivo.
16427011 p8/TTD-A, the tenth subunit of TFIIH, has a critical role in DNA repair where it triggers DNA opening by stimulating XPB ATPase activity together with the damage recognition factor XPC-hHR23B.

AA Sequence

MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQ      1 - 70
K//

Text Mined References (19)

PMID Year Title
27193682 2016 Near-atomic resolution visualization of human transcription promoter opening.
26463438 2016 The NER-related gene GTF2H5 predicts survival in high-grade serous ovarian cancer patients.
25620205 2015 TFIIH subunit alterations causing xeroderma pigmentosum and trichothiodystrophy specifically disturb several steps during transcription.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
23729738 2013 In vivo interactions of TTDA mutant proteins within TFIIH.
23637614 2013 Disruption of TTDA results in complete nucleotide excision repair deficiency and embryonic lethality.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
18270339 2008 Comprehensive analysis of DNA repair gene variants and risk of meningioma.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17350038 2007 Solution structure and self-association properties of the p8 TFIIH subunit responsible for trichothiodystrophy.
16669699 2006 Dynamic interaction of TTDA with TFIIH is stabilized by nucleotide excision repair in living cells.
16427011 2006 p8/TTD-A as a repair-specific TFIIH subunit.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15220921 2004 A new, tenth subunit of TFIIH is responsible for the DNA repair syndrome trichothiodystrophy group A.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9461396 1997 Molecular evolution of the second ancient human mariner transposon, Hsmar2, illustrates patterns of neutral evolution in the human genome lineage.