Property Summary

NCBI Gene PubMed Count 63
PubMed Score 19.85
PubTator Score 30.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Protein-protein Interaction (8)

Gene RIF (36)

AA Sequence

MESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAA      1 - 70
VALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDK     71 - 140
HARDVPSLDKYAEERWEVVLHFMVGSPSAAVSQDLAQLLSQAGLMKSTEPGEPPCITSAGFQFLLLDTPA    141 - 210
QLWYFMLQYLQTAQSRGMDLVEILSFLFQLSFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRR    211 - 280
YYPTRLAINLSSGVSGAGGTVHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRES    281 - 350
VQQAIASGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFEL    351 - 420
LLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS                                421 - 462
//

Text Mined References (65)

PMID Year Title