Property Summary

NCBI Gene PubMed Count 65
PubMed Score 20.21
PubTator Score 104.72

Knowledge Summary

Patent

No data available

Expression

Gene RIF (28)

AA Sequence

MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRT      1 - 70
MEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCH     71 - 140
GEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTV    141 - 210
LARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNT    211 - 280
EPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQG    281 - 350
ELKDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV                             351 - 395
//

Text Mined References (67)

PMID Year Title