Property Summary

NCBI Gene PubMed Count 61
PubMed Score 6.84
PubTator Score 104.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

 MGI Phenotype (1)

Gene RIF (27)

PMID Text
25801217 Advanced oxidation protein products down-regulate the expression of calcium transport channels through p44/42 MAPK signaling mechanisms in the small intestinal epithelium.
24944016 Together, these results suggest that p44/WDR77 expression causes the non-sensitivity of proliferating cells to TGFbeta signaling, thereby contributing to cellular proliferation during lung tumorigenesis.
23986795 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
21821450 No correlation was found for p44 and occludin gene copy number and spinal muscular atrophy
21558443 miR-27a was identified as a key regulator of p44 mRNA. Moreover, miR-27a was shown to destabilize the p44 subunit of the TFIIH complex during the G2-M phase, thereby modulating the transcriptional shutdown observed during this transition.
19154529 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of general transcription factor IIH, polypeptide 2 (GTF2H2, 44kDa) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17332483 Impaired transcription in IPF is associated with decreased concentrations of transcription factor II-H in alveolar macrophages and may alter the intraalveolar milieu in IPF.
15790571 solution structure of p44-(321-395) shows topology differs from other reported RING domains by a circular permutation of the extended secondary structure elements; mutagenesis suggests tight binding to p34 is mediated by hydrophobic interactions
14980221 p44 of TFIIH has a role in binding to the nonstructural protein of Rift Valley fever virus to form nuclear filamentous structures
14569024 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
12080057 p52 Mediates XPB function within the transcription/repair factor
10866664 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
10438593 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
10082552 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
10066804 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9765201 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9651670 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9570510 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9334327 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9311822 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9184228 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9121429 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9054383 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
8934526 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
8849451 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
8628270 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter

AA Sequence

MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRT      1 - 70
MEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCH     71 - 140
GEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTV    141 - 210
LARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNT    211 - 280
EPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQG    281 - 350
ELKDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV                             351 - 395
//

Text Mined References (63)

PMID Year Title
27193682 2016 Near-atomic resolution visualization of human transcription promoter opening.
25801217 2015 Advanced oxidation protein products decrease the expression of calcium transport channels in small intestinal epithelium via the p44/42 MAPK signaling pathway.
24944016 2014 P44/WDR77 restricts the sensitivity of proliferating cells to TGF? signaling.
21821450 2012 Correlation of SMN2, NAIP, p44, H4F5 and Occludin genes copy number with spinal muscular atrophy phenotype in Tunisian patients.
21558443 2011 MicroRNA-27a regulates basal transcription by targeting the p44 subunit of general transcription factor IIH.
21269460 2011 Initial characterization of the human central proteome.
19154529 2009 A population-based study of genotypic and phenotypic variability in children with spinal muscular atrophy.
17438371 2007 Detection and identification of transcription factors as interaction partners of alien in vivo.
17332483 2007 Impairment of alveolar macrophage transcription in idiopathic pulmonary fibrosis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15843171 2005 Varicella-zoster virus IE63 protein represses the basal transcription machinery by disorganizing the pre-initiation complex.
15790571 2005 Solution structure of the C-terminal domain of TFIIH P44 subunit reveals a novel type of C4C4 ring domain involved in protein-protein interactions.
15775968 2005 Thyrotropin receptor trafficking relies on the hScrib-betaPIX-GIT1-ARF6 pathway.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15220921 2004 A new, tenth subunit of TFIIH is responsible for the DNA repair syndrome trichothiodystrophy group A.
14980221 2004 TFIIH transcription factor, a target for the Rift Valley hemorrhagic fever virus.
14569024 2003 The Tat/TAR-dependent phosphorylation of RNA polymerase II C-terminal domain stimulates cotranscriptional capping of HIV-1 mRNA.
12646563 2003 Rrn3 becomes inactivated in the process of ribosomal DNA transcription.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393749 2002 Multiple interactions between RNA polymerase I, TIF-IA and TAF(I) subunits regulate preinitiation complex assembly at the ribosomal gene promoter.
12080057 2002 p52 Mediates XPB function within the transcription/repair factor TFIIH.
11445587 2001 A yeast four-hybrid system identifies Cdk-activating kinase as a regulator of the XPD helicase, a subunit of transcription factor IIH.
11319235 2001 A role of the C-terminal part of p44 in the promoter escape activity of transcription factor IIH.
11313499 2001 Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
10866664 2000 Tat modifies the activity of CDK9 to phosphorylate serine 5 of the RNA polymerase II carboxyl-terminal domain during human immunodeficiency virus type 1 transcription.
10583946 1999 Quality control by DNA repair.
10438593 1999 Direct evidence that HIV-1 Tat stimulates RNA polymerase II carboxyl-terminal domain hyperphosphorylation during transcriptional elongation.
10214908 DNA damage recognition during nucleotide excision repair in mammalian cells.
10082552 1999 Tat activates human immunodeficiency virus type 1 transcriptional elongation independent of TFIIH kinase.
10066804 1999 Tat-associated kinase (P-TEFb): a component of transcription preinitiation and elongation complexes.
9852112 1998 Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes.
9790902 1998 Cloning and characterization of three human cDNAs encoding mRNA (guanine-7-)-methyltransferase, an mRNA cap methylase.
9771713 1998 Mutations in the XPD helicase gene result in XP and TTD phenotypes, preventing interaction between XPD and the p44 subunit of TFIIH.
9765201 1998 The HIV-1 Tat cellular coactivator Tat-SF1 is a general transcription elongation factor.
9651670 1998 Transcriptional control: Tat cofactors and transcriptional elongation.
9582279 1998 Cloning and functional characterization of PTRF, a novel protein which induces dissociation of paused ternary transcription complexes.
9570510 1998 Tat, Tat-associated kinase, and transcription.
9512541 1998 Isolation and characterization of a human cDNA for mRNA 5'-capping enzyme.
9503025 1998 Sequence of a 131-kb region of 5q13.1 containing the spinal muscular atrophy candidate genes SMN and NAIP.
9405375 1997 Three transitions in the RNA polymerase II transcription complex during initiation.
9334327 1997 The HIV transactivator TAT binds to the CDK-activating kinase and activates the phosphorylation of the carboxy-terminal domain of RNA polymerase II.
9311822 1997 A human primary T-lymphocyte-derived human immunodeficiency virus type 1 Tat-associated kinase phosphorylates the C-terminal domain of RNA polymerase II and induces CAK activity.
9184228 1997 Purification of a Tat-associated kinase reveals a TFIIH complex that modulates HIV-1 transcription.
9130708 1997 Substrate specificity of the cdk-activating kinase (CAK) is altered upon association with TFIIH.
9121429 1997 The human immunodeficiency virus transactivator Tat interacts with the RNA polymerase II holoenzyme.
9118947 1997 Cloning and characterization of p52, the fifth subunit of the core of the transcription/DNA repair factor TFIIH.
9063743 1997 A multicopy transcription-repair gene, BTF2p44, maps to the SMA region and demonstrates SMA associated deletions.
9054383 1997 Association of Tat with purified HIV-1 and HIV-2 transcription preinitiation complexes.
8981949 1997 The gene encoding p44, a subunit of the transcription factor TFIIH, is involved in large-scale deletions associated with Werdnig-Hoffmann disease.
8946909 1996 The general transcription factors of RNA polymerase II.
8934526 1996 Enhanced processivity of RNA polymerase II triggered by Tat-induced phosphorylation of its carboxy-terminal domain.
8870499 1996 The multiple roles of transcription/repair factor TFIIH.
8849451 1996 Tat-SF1: cofactor for stimulation of transcriptional elongation by HIV-1 Tat.
8692842 1996 Human cyclin-dependent kinase-activating kinase exists in three distinct complexes.
8692841 1996 Isolation and characterization of two human transcription factor IIH (TFIIH)-related complexes: ERCC2/CAK and TFIIH.
8652557 1996 Interactions involving the human RNA polymerase II transcription/nucleotide excision repair complex TFIIH, the nucleotide excision repair protein XPG, and Cockayne syndrome group B (CSB) protein.
8628270 1996 Three functional classes of transcriptional activation domain.
8194529 1994 p44 and p34 subunits of the BTF2/TFIIH transcription factor have homologies with SSL1, a yeast protein involved in DNA repair.
7664335 1995 The Cockayne syndrome group A gene encodes a WD repeat protein that interacts with CSB protein and a subunit of RNA polymerase II TFIIH.
7552146 1995 A provisional transcript map of the spinal muscular atrophy (SMA) critical region.
2449431 1988 ATP activates transcription initiation from promoters by RNA polymerase II in a reversible step prior to RNA synthesis.
1939271 1991 Abortive initiation is increased only for the weakest members of a set of down mutants of the adenovirus 2 major late promoter.