Property Summary

NCBI Gene PubMed Count 82
PubMed Score 41.92
PubTator Score 34.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer 1.100 5.9e-03
hepatocellular carcinoma 1.200 2.0e-05
pancreatic cancer 1.200 4.0e-03
Waldenstrons macroglobulinemia 1.017 2.4e-02
tuberculosis and treatment for 6 months -2.300 4.3e-04
pancreatic carcinoma 1.200 4.0e-03
ovarian cancer -2.200 4.0e-09

 GO Function (1)

Gene RIF (31)

PMID Text
24403578 Virulence factor NSs of rift valley fever virus recruits the FBXO3 to degrade subunit p62 of general transcription factor TFIIH.
23986795 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
21543505 These data suggest that the RVFV NSs protein is able to interact with the TFIIH subunit p62 inside infected cells and promotes its degradation, which can occur directly in the nucleus.
21489275 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
20974803 cdk1 phosphorylates p62 in vitro and in vivo at T269 and S272, which is necessary for the maintenance of appropriate cyclin B1 levels and the levels of cdk1 activity necessary to allow cells to properly enter and exit mitosis.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of general transcription factor IIH, polypeptide 1 (GTF2H1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18692935 GTF2H1 polymorphisms/haplotypes may contribute to genetic susceptibility to lung cancer.
18692935 Observational study of gene-disease association. (HuGE Navigator)
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
15909982 The pleckstrin homology domain from the 62 kDa subunit Tfb1 (residues 1-108) of TFIIH is sufficient for binding to the activation domain of herpes simplex virus protein VP16.
15625236 p62 subunit of TFIIH interacts with TRbeta in a ligand-dependent manner.
14569024 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
14500720 transcription factor b3, previously identified as a component of the transcription factor IIH core complex, is shown instead to be transcription factor b4
12379213 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
10866664 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
10438593 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
10082552 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
10066804 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9765201 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9651670 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9570510 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9334327 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9311822 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9184228 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9121429 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9054383 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
8934526 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
8849451 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
8628270 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter

AA Sequence

MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLH      1 - 70
AGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQEDPVLFQLYKDLVVSQVISAE     71 - 140
EFWANRLNVNATDSSSTSNHKQDVGISAAFLADVRPQTDGCNGLRYNLTSDIIESIFRTYPAVKMKYAEN    141 - 210
VPHNMTEKEFWTRFFQSHYFHRDRLNTGSKDLFAECAKIDEKGLKTMVSLGVKNPLLDLTALEDKPLDEG    211 - 280
YGISSVPSASNSKSIKENSNAAIIKRFNHHSAMVLAAGLRKQEAQNEQTSEPSNMDGNSGDADCFQPAVK    281 - 350
RAKLQESIEYEDLGKNNSVKTIALNLKKSDRYYHGPTPIQSLQYATSQDIINSFQSIRQEMEAYTPKLTQ    351 - 420
VLSSSAASSTITALSPGGALMQGGTQQAINQMVPNDIQSELKHLYVAVGELLRHFWSCFPVNTPFLEEKV    421 - 490
VKMKSNLERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQSRRLMKKT                491 - 548
//

Text Mined References (87)

PMID Year Title
24816252 2014 An atlas of genetic influences on human blood metabolites.
24403578 2014 Virulence factor NSs of rift valley fever virus recruits the F-box protein FBXO3 to degrade subunit p62 of general transcription factor TFIIH.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23180869 2014 Genome-wide association study of survival in patients with pancreatic adenocarcinoma.
21543505 2011 NSs protein of rift valley fever virus promotes posttranslational downregulation of the TFIIH subunit p62.
21269460 2011 Initial characterization of the human central proteome.
21124955 2010 Genome-wide association study identifies two novel regions at 11p15.5-p13 and 1p31 with major impact on acute-phase serum amyloid A.
20974803 2011 Phosphorylation of p62 by cdk1 controls the timely transit of cells through mitosis and tumor cell proliferation.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18692935 2009 Genetic variants in GTF2H1 and risk of lung cancer: a case-control analysis in a Chinese population.
18354501 2008 Structural insight into the TFIIE-TFIIH interaction: TFIIE and p53 share the binding region on TFIIH.
18270339 2008 Comprehensive analysis of DNA repair gene variants and risk of meningioma.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15909982 2005 NMR structure of the amino-terminal domain from the Tfb1 subunit of TFIIH and characterization of its phosphoinositide and VP16 binding sites.
15625236 2005 p62, A TFIIH subunit, directly interacts with thyroid hormone receptor and enhances T3-mediated transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15220921 2004 A new, tenth subunit of TFIIH is responsible for the DNA repair syndrome trichothiodystrophy group A.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14569024 2003 The Tat/TAR-dependent phosphorylation of RNA polymerase II C-terminal domain stimulates cotranscriptional capping of HIV-1 mRNA.
14500720 2003 Revised subunit structure of yeast transcription factor IIH (TFIIH) and reconciliation with human TFIIH.
12665589 2003 The carboxy terminus of the small subunit of TFIIE regulates the transition from transcription initiation to elongation by RNA polymerase II.
12646563 2003 Rrn3 becomes inactivated in the process of ribosomal DNA transcription.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12453423 2002 Rapid switching of TFIIH between RNA polymerase I and II transcription and DNA repair in vivo.
12393749 2002 Multiple interactions between RNA polymerase I, TIF-IA and TAF(I) subunits regulate preinitiation complex assembly at the ribosomal gene promoter.
12392551 2002 Distinct parts of minichromosome maintenance protein 2 associate with histone H3/H4 and RNA polymerase II holoenzyme.
12379213 2002 Transcription factor TFIIH components enhance the GR coactivator activity but not the cell cycle-arresting activity of the human immunodeficiency virus type-1 protein Vpr.
11313499 2001 Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
11266437 2001 Androgen receptor interacts with the positive elongation factor P-TEFb and enhances the efficiency of transcriptional elongation.
11259578 2001 Strong functional interactions of TFIIH with XPC and XPG in human DNA nucleotide excision repair, without a preassembled repairosome.
11239393 2001 Defective interplay of activators and repressors with TFIH in xeroderma pigmentosum.
11118327 2000 Tissue and cell distribution of a mammalian proteasomal ATPase, MSS1, and its complex formation with the basal transcription factors.
11113176 2001 Studies of nematode TFIIE function reveal a link between Ser-5 phosphorylation of RNA polymerase II and the transition from transcription initiation to elongation.
11071939 2000 Cloning of a human homolog of the yeast nucleotide excision repair gene MMS19 and interaction with transcription repair factor TFIIH via the XPB and XPD helicases.
10949034 2000 Activation of estrogen receptor alpha by S118 phosphorylation involves a ligand-dependent interaction with TFIIH and participation of CDK7.
10882074 2000 The FBP interacting repressor targets TFIIH to inhibit activated transcription.
10866664 2000 Tat modifies the activity of CDK9 to phosphorylate serine 5 of the RNA polymerase II carboxyl-terminal domain during human immunodeficiency virus type 1 transcription.
10777215 2000 A murine ATFa-associated factor with transcriptional repressing activity.
10734143 2000 The xeroderma pigmentosum group C protein complex XPC-HR23B plays an important role in the recruitment of transcription factor IIH to damaged DNA.
10734072 2000 From androgen receptor to the general transcription factor TFIIH. Identification of cdk activating kinase (CAK) as an androgen receptor NH(2)-terminal associated coactivator.
10583946 1999 Quality control by DNA repair.
10490622 1999 hnRNP U inhibits carboxy-terminal domain phosphorylation by TFIIH and represses RNA polymerase II elongation.
10467411 1999 Evidence for SH3 domain directed binding and phosphorylation of Sam68 by Src.
10438593 1999 Direct evidence that HIV-1 Tat stimulates RNA polymerase II carboxyl-terminal domain hyperphosphorylation during transcriptional elongation.
10428966 1999 Residues phosphorylated by TFIIH are required for E2F-1 degradation during S-phase.
10214908 DNA damage recognition during nucleotide excision repair in mammalian cells.
10082552 1999 Tat activates human immunodeficiency virus type 1 transcriptional elongation independent of TFIIH kinase.
10066804 1999 Tat-associated kinase (P-TEFb): a component of transcription preinitiation and elongation complexes.
9852112 1998 Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes.
9837719 1998 Ku70/Ku80 protein complex inhibits the binding of nucleotide excision repair proteins on linear DNA in vitro.
9790902 1998 Cloning and characterization of three human cDNAs encoding mRNA (guanine-7-)-methyltransferase, an mRNA cap methylase.
9774388 1998 RNA polymerase II elongation complexes containing the Cockayne syndrome group B protein interact with a molecular complex containing the transcription factor IIH components xeroderma pigmentosum B and p62.
9765293 1998 FCP1, the RAP74-interacting subunit of a human protein phosphatase that dephosphorylates the carboxyl-terminal domain of RNA polymerase IIO.
9765201 1998 The HIV-1 Tat cellular coactivator Tat-SF1 is a general transcription elongation factor.
9710619 1998 A human RNA polymerase II complex containing factors that modify chromatin structure.
9698541 1998 Interactions of the transcription/DNA repair factor TFIIH and XP repair proteins with DNA lesions in a cell-free repair assay.
9651670 1998 Transcriptional control: Tat cofactors and transcriptional elongation.
9630526 1998 Genomic organization and promoter characterization of the mouse and human genes encoding p62 subunit of the transcription/DNA repair factor TFIIH.
9582279 1998 Cloning and functional characterization of PTRF, a novel protein which induces dissociation of paused ternary transcription complexes.
9570510 1998 Tat, Tat-associated kinase, and transcription.
9512541 1998 Isolation and characterization of a human cDNA for mRNA 5'-capping enzyme.
9405375 1997 Three transitions in the RNA polymerase II transcription complex during initiation.
9334327 1997 The HIV transactivator TAT binds to the CDK-activating kinase and activates the phosphorylation of the carboxy-terminal domain of RNA polymerase II.
9311822 1997 A human primary T-lymphocyte-derived human immunodeficiency virus type 1 Tat-associated kinase phosphorylates the C-terminal domain of RNA polymerase II and induces CAK activity.
9184228 1997 Purification of a Tat-associated kinase reveals a TFIIH complex that modulates HIV-1 transcription.
9130708 1997 Substrate specificity of the cdk-activating kinase (CAK) is altered upon association with TFIIH.
9121429 1997 The human immunodeficiency virus transactivator Tat interacts with the RNA polymerase II holoenzyme.
9118947 1997 Cloning and characterization of p52, the fifth subunit of the core of the transcription/DNA repair factor TFIIH.
9054383 1997 Association of Tat with purified HIV-1 and HIV-2 transcription preinitiation complexes.
8946909 1996 The general transcription factors of RNA polymerase II.
8934526 1996 Enhanced processivity of RNA polymerase II triggered by Tat-induced phosphorylation of its carboxy-terminal domain.
8849451 1996 Tat-SF1: cofactor for stimulation of transcriptional elongation by HIV-1 Tat.
8692842 1996 Human cyclin-dependent kinase-activating kinase exists in three distinct complexes.
8692841 1996 Isolation and characterization of two human transcription factor IIH (TFIIH)-related complexes: ERCC2/CAK and TFIIH.
8652557 1996 Interactions involving the human RNA polymerase II transcription/nucleotide excision repair complex TFIIH, the nucleotide excision repair protein XPG, and Cockayne syndrome group B (CSB) protein.
8628270 1996 Three functional classes of transcriptional activation domain.
8194528 1994 The ERCC2/DNA repair protein is associated with the class II BTF2/TFIIH transcription factor.
8162052 1994 Genes encoding general initiation factors for RNA polymerase II transcription are dispersed in the human genome.
7935417 1994 Binding of basal transcription factor TFIIH to the acidic activation domains of VP16 and p53.
7789978 1995 A high-resolution integrated physical, cytogenetic, and genetic map of human chromosome 11: distal p13 to proximal p15.1.
7724549 1995 The 62- and 80-kDa subunits of transcription factor IIH mediate the interaction with Epstein-Barr virus nuclear protein 2.
7533895 1995 Cdk-activating kinase complex is a component of human transcription factor TFIIH.
2449431 1988 ATP activates transcription initiation from promoters by RNA polymerase II in a reversible step prior to RNA synthesis.
1939271 1991 Abortive initiation is increased only for the weakest members of a set of down mutants of the adenovirus 2 major late promoter.
1529339 1992 Cloning of the 62-kilodalton component of basic transcription factor BTF2.