Property Summary

NCBI Gene PubMed Count 88
PubMed Score 45.95
PubTator Score 34.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
pancreatic cancer 1.200 4.0e-03
gastric cancer 1.100 5.9e-03
hepatocellular carcinoma 1.200 2.0e-05
ovarian cancer -2.200 4.0e-09
pancreatic carcinoma 1.200 4.0e-03
tuberculosis and treatment for 3 months -1.500 2.0e-03
Waldenstrons macroglobulinemia 1.017 2.4e-02

 GO Function (1)

Gene RIF (34)

AA Sequence

MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLH      1 - 70
AGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQEDPVLFQLYKDLVVSQVISAE     71 - 140
EFWANRLNVNATDSSSTSNHKQDVGISAAFLADVRPQTDGCNGLRYNLTSDIIESIFRTYPAVKMKYAEN    141 - 210
VPHNMTEKEFWTRFFQSHYFHRDRLNTGSKDLFAECAKIDEKGLKTMVSLGVKNPLLDLTALEDKPLDEG    211 - 280
YGISSVPSASNSKSIKENSNAAIIKRFNHHSAMVLAAGLRKQEAQNEQTSEPSNMDGNSGDADCFQPAVK    281 - 350
RAKLQESIEYEDLGKNNSVKTIALNLKKSDRYYHGPTPIQSLQYATSQDIINSFQSIRQEMEAYTPKLTQ    351 - 420
VLSSSAASSTITALSPGGALMQGGTQQAINQMVPNDIQSELKHLYVAVGELLRHFWSCFPVNTPFLEEKV    421 - 490
VKMKSNLERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQSRRLMKKT                491 - 548
//

Text Mined References (93)

PMID Year Title