Property Summary

NCBI Gene PubMed Count 72
PubMed Score 42.79
PubTator Score 64.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Mixed connective tissue disease 16 3.148 1.6

Expression

Protein-protein Interaction (229)

SUPT5H   TAF4   U2SURP   DHX15   RNMT   PRPF4   SART1   HNRNPR   PRPF3   PPIH   PLRG1   NUDT21   DHX16   AQR   CDC40   CCNT1   PQBP1   RNGTT   PRPF40A   SF3B1   WBP4   SNRNP200   CCNK   BCAS2   SMNDC1   PRPF6   PCF11   CD2BP2   CPSF4   LSM8   SYF2   HNRNPC   SNRPB2   SNRNP70   SNRPA   HNRNPA1   SNRPA1   GTF2F2   SNRPB   HNRNPL   ERCC2   ERCC3   TBP   HNRNPA2B1   TCEA1   U2AF2   PTBP1   TIA1   HNRNPH1   GTF2H1   CSTF2   RBMX   CDK7   CDK9   PAPOLA   CCNH   MNAT1   HNRNPA3   HNRNPM   HNRNPF   ZNF143   SNU13   HNRNPH2   HNRNPK   SNRPE   SNRPF   SNRPG   LSM3   LSM6   SNRPD1   SNRPD2   SNRPD3   TRA2B   SNURF   YBX1   LSM11   TXNL4A   SRSF3   GTF2B   HNRNPU   U2AF1   TIAL1   SRSF2   CSTF1   SRSF1   SRSF4   CPSF1   SF3A3   CSTF3   HNRNPA0   SRSF9   SRSF5   SRSF6   SF3B2   GTF2H2   GTF2H3   HNRNPD   ELOA   SLBP   WTAP   EFTUD2   RNPS1   PCBP1   PCBP2   ELOC   ELOB   SF3B3   SF3B4   SF3A2   SF3A1   TAF13   TAF7   SF1   ZRSR2   SNRNP35   TAF9   USP39   SNAPC4   CPSF3L   RPRD2   TAF3   ICE2   INTS3   SNRNP48   ESRP1   CDC73   TAF2   PRPF8   INTS5   CTR9   FIP1L1   CWC27   GTF2H5   INTS8   SUPT6H   DDX46   PHF5A   TAF8   PABPN1   METTL3   ALYREF   DDX42   CHERP   SUGP1   CCAR1   NELFCD   RPAP2   SRRM1   ELOA2   TAF1L   INTS1   ZC3H8   CPSF7   PAF1   PDCD7   PRPF38A   ELOA3   ZCRB1   ZNF473   U2AF1L4   LEO1   SNRNP27   PRPF31   NELFB   RTF1   DHX38   GTF2H4   GPKOW   CLP1   LSM10   MAGOHB   NABP1   PPWD1   INTS12   EAF2   SNRNP40   INTS4   RBM17   EAF1   RNPC3   RPRD1A   IWS1   VWA9   CDC5L   NABP2   HNRNPUL1   DDX23   SNRNP25   SF3B5   UPF3B   CRNKL1   WDR33   WDR61   INTS2   CSTF2T   NELFA   ESRP2   PHAX   ELL3   TAF9B   METTL14   CWC22   XAB2   INTS9   INTS7   ASUN   INTS10   RBM22   CWC25   CDK12   CWC15   CPSF2   ZMAT5   AFF4   PUF60   LSM7   CPSF3   INTS6   ISY1   PRPF19   SRRM2   ICE1   WBP11   LSM2   LSM5   LSM4   CTDP1   SUPT16H   RBM8A  

Gene RIF (27)

PMID Text
22343046 These results suggest that Mediator structural shifts induced by activator binding help stably orient pol II prior to transcription initiation within the human mediator-RNA polymerase II-TFIIF assembly.
22244332 Gdown1 competes with TFIIF for binding to the RPB1 and RPB5 subunits of Pol II, thereby inhibiting an essential function of TFIIF in preinitiation complex assembly.
21896726 Data show that TFIIF has an important role in stabilizing TFIIB within the PIC and after transcription initiates.
21489275 HIV-1 Tat inhibits the binding of RAP74 amino acids 436-517 to FCP1
19215094 NMR and thermodynamic studies further elucidate the complex molecular mechanism by which TFIIF and FCP1 cooperate for RNAPII recycling.
18976975 Knockdown of general transcription factor IIF, polypeptide 1 (GTF2F1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18950845 Observational study of gene-disease association. (HuGE Navigator)
18284209 Mutated hydrophobic residues in RAP74 C-terminal structure disrupt secondary structure elements, showing that binding of the androgen receptor N-terminal domain depends upon helix 3 in the winged-helix domain of the RAP74 C-terminal domain polypeptide.
17848138 TFIIF and Rpb7 are involved in both early and late transcriptional stages
15831464 alpha1-Helix of RAP74 is important for supporting NTP-driven translocation by RNAP II.
15723517 HIV-1 Tat inhibits the binding of RAP74 amino acids 436-517 to FCP1
15351637 TFIIF supports elongation and suppresses pausing by stabilizing the post-translocated elongation complex
15023052 Interaction of TFIIF subunit RAP74 with recombinant androgen receptor N-terminal activation domain AF1 leads to imposition of helical structure on the AF1 domain.
12775419 HIV-1 Tat inhibits the binding of RAP74 amino acids 436-517 to FCP1
12732728 NMR structure of a complex containing this TFIIF subunit and the RNA polymerase II carboxyl-terminal domain phosphatase FCP1.
12591941 cocrystal structure of the winged-helix domain of human RNA polymerase II-associating protein 74 bound to the alpha-helical C terminus of human FCP1
12578358 The NMR solution structure of the C-terminal domain of RAP74 has been determined, and NMR methods have been used to map the binding sites of the C-terminus of CTD phosphatase/FCP1 on the RAP74 C-terminal fragment.
12354769 The alpha 1 helix of human RAP74 has an important role in the initiation and elongation of RNA chains
12351650 role of associated carboxyl-terminal domain phosphatase in dephosphorylating phosphoserines 2 and 5 of RNA polymerase II
12089333 HIV-1 Tat inhibits the binding of RAP74 amino acids 436-517 to FCP1
10704353 HIV-1 Tat inhibits the binding of RAP74 amino acids 436-517 to FCP1
10454543 HIV-1 Tat inhibits the binding of RAP74 amino acids 436-517 to FCP1
9765201 HIV-1 Tat inhibits the binding of RAP74 amino acids 436-517 to FCP1
9121429 HIV-1 Tat inhibits the binding of RAP74 amino acids 436-517 to FCP1
8934526 HIV-1 Tat inhibits the binding of RAP74 amino acids 436-517 to FCP1
8849451 HIV-1 Tat inhibits the binding of RAP74 amino acids 436-517 to FCP1
1559613 HIV-1 Tat inhibits the binding of RAP74 amino acids 436-517 to FCP1

AA Sequence

MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSE      1 - 70
FNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPV     71 - 140
HNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDL    141 - 210
EDDLEMSSDASDASGEEGGRVPKAKKKAPLAKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSS    211 - 280
SQEEPESKAKAPQQEEGPKGVDEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEE    281 - 350
SDIDSEASSALFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSSTLRAAASKLEQGKRVSEMPAA    351 - 420
KRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTV    421 - 490
NVLAQILKRLNPERKMINDKMHFSLKE                                               491 - 517
//

Text Mined References (84)

PMID Year Title
27193682 2016 Near-atomic resolution visualization of human transcription promoter opening.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22343046 2012 Activator-mediator binding stabilizes RNA polymerase II orientation within the human mediator-RNA polymerase II-TFIIF assembly.
22244332 2012 Transcriptional regulation by Pol II(G) involving mediator and competitive interactions of Gdown1 and TFIIF with Pol II.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21896726 2011 Transcription factor TFIIF is not required for initiation by RNA polymerase II, but it is essential to stabilize transcription factor TFIIB in early elongation complexes.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19215094 2009 NMR structure of a complex formed by the carboxyl-terminal domain of human RAP74 and a phosphorylated peptide from the central domain of the FCP1 phosphatase.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18284209 2008 Functional characterization of the native NH2-terminal transactivation domain of the human androgen receptor: binding kinetics for interactions with TFIIF and SRC-1a.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17848138 2008 Genomic location of the human RNA polymerase II general machinery: evidence for a role of TFIIF and Rpb7 at both early and late stages of transcription.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16905668 2006 Arabidopsis carboxyl-terminal domain phosphatase-like isoforms share common catalytic and interaction domains but have distinct in planta functions.
16548883 2006 Transcriptomic and proteomic analyses of rhabdomyosarcoma cells reveal differential cellular gene expression in response to enterovirus 71 infection.
16097034 2005 Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC.
16083285 Global phosphoproteome of HT-29 human colon adenocarcinoma cells.
15831464 2005 Human RNA polymerase II elongation in slow motion: role of the TFIIF RAP74 alpha1 helix in nucleoside triphosphate-driven translocation.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15351637 2004 Transcription factors IIF and IIS and nucleoside triphosphate substrates as dynamic probes of the human RNA polymerase II mechanism.
15023052 2004 Induced alpha-helix structure in AF1 of the androgen receptor upon binding transcription factor TFIIF.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12737519 2003 Interaction with general transcription factor IIF (TFIIF) is required for the suppression of activated transcription by RPB5-mediating protein (RMP).
12732728 2003 NMR structure of a complex containing the TFIIF subunit RAP74 and the RNA polymerase II carboxyl-terminal domain phosphatase FCP1.
12721286 2003 A novel RNA polymerase II C-terminal domain phosphatase that preferentially dephosphorylates serine 5.
12676794 2003 The RNA polymerase II elongation complex.
12591941 2003 Molecular mechanism of recruitment of TFIIF- associating RNA polymerase C-terminal domain phosphatase (FCP1) by transcription factor IIF.
12578358 2003 Solution structure of the carboxyl-terminal domain of RAP74 and NMR characterization of the FCP1-binding sites of RAP74 and human TFIIB.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12354769 2002 A key role for the alpha 1 helix of human RAP74 in the initiation and elongation of RNA chains.
12351650 2002 TFIIF-associating carboxyl-terminal domain phosphatase dephosphorylates phosphoserines 2 and 5 of RNA polymerase II.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11509574 2001 Structural and functional interactions of transcription factor (TF) IIA with TFIIE and TFIIF in transcription initiation by RNA polymerase II.
11248041 2001 Crystal structure of the C-terminal domain of the RAP74 subunit of human transcription factor IIF.
11183778 2000 Novel dimerization fold of RAP30/RAP74 in human TFIIF at 1.7 A resolution.
11118325 2000 The RNA aptamer-binding site of hepatitis C virus NS3 protease.
11113176 2001 Studies of nematode TFIIE function reveal a link between Ser-5 phosphorylation of RNA polymerase II and the transition from transcription initiation to elongation.
10777215 2000 A murine ATFa-associated factor with transcriptional repressing activity.
10704353 2000 Phosphorylation of the RAP74 subunit of TFIIF correlates with Tat-activated transcription of the HIV-1 long terminal repeat.
10567562 1999 The RAP74 subunit of human transcription factor IIF has similar roles in initiation and elongation.
10454543 1999 Tat-SF1 protein associates with RAP30 and human SPT5 proteins.
10428810 1999 Kinase activity and phosphorylation of the largest subunit of TFIIF transcription factor.
9790902 1998 Cloning and characterization of three human cDNAs encoding mRNA (guanine-7-)-methyltransferase, an mRNA cap methylase.
9765293 1998 FCP1, the RAP74-interacting subunit of a human protein phosphatase that dephosphorylates the carboxyl-terminal domain of RNA polymerase IIO.
9765201 1998 The HIV-1 Tat cellular coactivator Tat-SF1 is a general transcription elongation factor.
9677423 1998 Analysis of the role of TFIIE in transcriptional regulation through structure-function studies of the TFIIEbeta subunit.
9660973 1998 Functional analysis of the human TAFII250 N-terminal kinase domain.
9512541 1998 Isolation and characterization of a human cDNA for mRNA 5'-capping enzyme.
9409616 1997 Purification and cDNA cloning of the AdoMet-binding subunit of the human mRNA (N6-adenosine)-methyltransferase.
9405375 1997 Three transitions in the RNA polymerase II transcription complex during initiation.
9265625 1997 Structure-function analysis of Msx2-mediated transcriptional suppression.
9238003 1997 Interaction of the human androgen receptor transactivation function with the general transcription factor TFIIF.
9121429 1997 The human immunodeficiency virus transactivator Tat interacts with the RNA polymerase II holoenzyme.
8946909 1996 The general transcription factors of RNA polymerase II.
8934526 1996 Enhanced processivity of RNA polymerase II triggered by Tat-induced phosphorylation of its carboxy-terminal domain.
8849451 1996 Tat-SF1: cofactor for stimulation of transcriptional elongation by HIV-1 Tat.
8755740 1996 Functional interaction of the c-Myc transactivation domain with the TATA binding protein: evidence for an induced fit model of transactivation domain folding.
8662660 1996 RNA polymerase II-associated protein (RAP) 74 binds transcription factor (TF) IIB and blocks TFIIB-RAP30 binding.
8625415 1996 TAFII250 is a bipartite protein kinase that phosphorylates the base transcription factor RAP74.
8486367 1993 Assignment of the human GTF2F1 gene to chromosome 19p13.3.
8441635 1993 Domain structure of a human general transcription initiation factor, TFIIF.
8106390 1994 Role of transcription factor TFIIF in serum response factor-activated transcription.
7890767 1995 Structure and function of the small subunit of TFIIF (RAP30) from Drosophila melanogaster.
7854423 1995 Interaction with RAP74 subunit of TFIIF is required for transcriptional activation by serum response factor.
7667268 1995 Evolutionary conservation of human TATA-binding-polypeptide-associated factors TAFII31 and TAFII80 and interactions of TAFII80 with other TAFs and with general transcription factors.
7590250 1995 Human TAFII250 interacts with RAP74: implications for RNA polymerase II initiation.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.
2449431 1988 ATP activates transcription initiation from promoters by RNA polymerase II in a reversible step prior to RNA synthesis.
1939271 1991 Abortive initiation is increased only for the weakest members of a set of down mutants of the adenovirus 2 major late promoter.
1734284 1992 A cDNA encoding RAP74, a general initiation factor for transcription by RNA polymerase II.
1734283 1992 Characterization of cDNA for the large subunit of the transcription initiation factor TFIIF.
1559613 1992 HIV-1 Tat acts as a processivity factor in vitro in conjunction with cellular elongation factors.