Property Summary

NCBI Gene PubMed Count 44
PubMed Score 1.64
PubTator Score 13.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
ovarian cancer 8491 1.7e-03
Disease Target Count Z-score Confidence
Werner syndrome 29 4.004 2.0
Tendinitis 13 3.693 1.8
Disease Target Count
Photosensitive trichothiodystrophy 24

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.400 1.7e-03

 MGI Phenotype (1)

Gene RIF (12)

PMID Text
26996949 We underline role of TFIIE in transcription and its distinction from nucleotide excision repair. Trichothiodystrophy individuals with mutations in GTF2E2 highlight the importance of the direct interaction between TFIIH and TFIIE in transcription process.
25308091 PC4 plays essential roles in the transition step from transcription initiation to elongation by binding to melted DNA in collaboration with TFIIEbeta.
22404213 Knockdown of general transcription factor IIE, polypeptide 2, beta 34kDa (GTF2E2; TFIIE-B) by siRNA inhibits HIV-1 replication in CD4+/CCR5+/CXCR4+ TZM-bl HeLa cells
21489275 HIV-1 Tat interacts with the RNA polymerase II holoenzyme and transcription preinitiation complexes, which include TFIIE, during Tat-mediated transactivation of the HIV-1 LTR
19861958 Observational study of gene-disease association. (HuGE Navigator)
19210545 These data suggest a model in which TFIIE binds to a position adjacent to the initiation site via the forkhead domain, enabling TFIIH to begin opening the promoter.
16547462 TFIIE is an alpha/beta heterodimer in solution; A model for the quaternary architecture of the complex is proposed that provides a structural framework to discuss the function of TFIIE in the context of RNA polymerase II transcription initiation.
12665589 introduced point mutations into two regions located near the carboxy terminus of TFIIE beta and identified the functionally essential amino acid residues that bind to RNA polymerase II
9121429 HIV-1 Tat interacts with the RNA polymerase II holoenzyme and transcription preinitiation complexes, which include TFIIE, during Tat-mediated transactivation of the HIV-1 LTR
9054383 HIV-1 Tat interacts with the RNA polymerase II holoenzyme and transcription preinitiation complexes, which include TFIIE, during Tat-mediated transactivation of the HIV-1 LTR
8934526 HIV-1 Tat interacts with the RNA polymerase II holoenzyme and transcription preinitiation complexes, which include TFIIE, during Tat-mediated transactivation of the HIV-1 LTR
8849451 HIV-1 Tat interacts with the RNA polymerase II holoenzyme and transcription preinitiation complexes, which include TFIIE, during Tat-mediated transactivation of the HIV-1 LTR

AA Sequence

MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGS      1 - 70
SGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFK     71 - 140
PKYNVRDKKALLRLLDQHDQRGLGGILLEDIEEALPNSQKAVKALGDQILFVNRPDKKKILFFNDKSCQF    141 - 210
SVDEEFQKLWRSVTVDSMDEEKIEEYLKRQGISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGV    211 - 280
LKDYSDITSSK                                                               281 - 291
//

Text Mined References (48)

PMID Year Title
27193682 2016 Near-atomic resolution visualization of human transcription promoter opening.
26996949 2016 GTF2E2 Mutations Destabilize the General Transcription Factor Complex TFIIE in Individuals with DNA Repair-Proficient Trichothiodystrophy.
25308091 2014 Transcription cofactor PC4 plays essential roles in collaboration with the small subunit of general transcription factor TFIIE.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
19861958 2010 Genetic analysis in a Dutch study sample identifies more ulcerative colitis susceptibility loci and shows their additive role in disease risk.
19210545 2009 Central forkhead domain of human TFIIE beta plays a primary role in binding double-stranded DNA at transcription initiation.
19106100 2009 MCAF1/AM is involved in Sp1-mediated maintenance of cancer-associated telomerase activity.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16547462 2006 Structure and oligomeric state of human transcription factor TFIIE.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12665589 2003 The carboxy terminus of the small subunit of TFIIE regulates the transition from transcription initiation to elongation by RNA polymerase II.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11509574 2001 Structural and functional interactions of transcription factor (TF) IIA with TFIIE and TFIIF in transcription initiation by RNA polymerase II.
11416139 2001 Inhibition of androgen receptor-mediated transcription by amino-terminal enhancer of split.
11113176 2001 Studies of nematode TFIIE function reveal a link between Ser-5 phosphorylation of RNA polymerase II and the transition from transcription initiation to elongation.
10827951 2000 Mechanism of ATP-dependent promoter melting by transcription factor IIH.
10792464 2000 Functional interaction of general transcription initiation factor TFIIE with general chromatin factor SPT16/CDC68.
10777215 2000 A murine ATFa-associated factor with transcriptional repressing activity.
9677423 1998 Analysis of the role of TFIIE in transcriptional regulation through structure-function studies of the TFIIEbeta subunit.
9618479 1998 An interplay between TATA box-binding protein and transcription factors IIE and IIA modulates DNA binding and transcription.
9418848 1998 Involvement of negative cofactor NC2 in active repression by zinc finger-homeodomain transcription factor AREB6.
9405375 1997 Three transitions in the RNA polymerase II transcription complex during initiation.
9271120 1997 Repression of p53-mediated transcription by MDM2: a dual mechanism.
9121429 1997 The human immunodeficiency virus transactivator Tat interacts with the RNA polymerase II holoenzyme.
9089417 1997 Transcriptional activation domain of human BTEB2, a GC box-binding factor.
9054383 1997 Association of Tat with purified HIV-1 and HIV-2 transcription preinitiation complexes.
8999876 1997 Human transcription-repair coupling factor CSB/ERCC6 is a DNA-stimulated ATPase but is not a helicase and does not disrupt the ternary transcription complex of stalled RNA polymerase II.
8946909 1996 The general transcription factors of RNA polymerase II.
8934526 1996 Enhanced processivity of RNA polymerase II triggered by Tat-induced phosphorylation of its carboxy-terminal domain.
8849451 1996 Tat-SF1: cofactor for stimulation of transcriptional elongation by HIV-1 Tat.
8786118 1996 Integrated map of the chromosome 8p12-p21 region, a region involved in human cancers and Werner syndrome.
8152490 1994 Dual role of TFIIH in DNA excision repair and in transcription by RNA polymerase II.
7926747 1994 Transcription factor IIE binds preferentially to RNA polymerase IIa and recruits TFIIH: a model for promoter clearance.
7876263 1995 The general transcription-repair factor TFIIH is recruited to the excision repair complex by the XPA protein independent of the TFIIE transcription factor.
7651391 1995 The Epstein-Barr virus nuclear protein 2 acidic domain forms a complex with a novel cellular coactivator that can interact with TFIIE.
3029109 1987 Factors involved in specific transcription by mammalian RNA polymerase II. Purification and functional analysis of initiation factors IIB and IIE.
2449431 1988 ATP activates transcription initiation from promoters by RNA polymerase II in a reversible step prior to RNA synthesis.
2251258 1990 Factors involved in specific transcription by mammalian RNA polymerase II: purification and characterization of general transcription factor TFIIE.
2026628 1991 Factors involved in specific transcription by mammalian RNA polymerase II. Purification and functional analysis of general transcription factor IIE.
1956404 1991 Conserved sequence motifs in the small subunit of human general transcription factor TFIIE.
1956398 1991 Structure and functional properties of human general transcription factor IIE.
1939271 1991 Abortive initiation is increased only for the weakest members of a set of down mutants of the adenovirus 2 major late promoter.