Property Summary

NCBI Gene PubMed Count 41
PubMed Score 0.33
PubTator Score 15.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3163 4.1e-07
hepatocellular carcinoma 550 5.6e-05
ovarian cancer 8491 1.9e-03
lung cancer 4473 5.0e-03
Breast cancer 3098 2.7e-02
Disease Target Count Z-score Confidence
Photosensitive trichothiodystrophy 24 4.448 2.2

Expression

  Differential Expression (5)

Disease log2 FC p
hepatocellular carcinoma 1.200 5.6e-05
malignant mesothelioma 1.300 4.1e-07
lung cancer 1.200 5.0e-03
Breast cancer 2.700 2.7e-02
ovarian cancer 1.200 1.9e-03

Gene RIF (12)

PMID Text
25492609 Association of the winged helix motif of the TFIIEalpha subunit of TFIIE with either the TFIIEbeta subunit or TFIIB distinguishes its functions in transcription.
22404213 Knockdown of general transcription factor IIE, polypeptide 1, alpha 56kDa (GTF2E1; TFIIE1) by siRNA inhibits HIV-1 replication in CD4+/CCR5+/CXCR4+ TZM-bl HeLa cells
21489275 HIV-1 Tat interacts with the RNA polymerase II holoenzyme and transcription preinitiation complexes, which include TFIIE, during Tat-mediated transactivation of the HIV-1 LTR
18950845 Observational study of gene-disease association. (HuGE Navigator)
18354501 The specific binding of the C-terminal acidic domain (AC-D) of the human TFIIEalpha subunit to the pleckstrin homology domain (PH-D) of the human TFIIH p62 subunit is demonstrated.
18160537 interplay between TFIIEalpha and the tumor suppressor protein p53 in regulating transcriptional activation that may be modulated by the phosphorylation status of p53
16547462 TFIIE is an alpha/beta heterodimer in solution. A model for the quaternary architecture of the complex is proposed that provides a structural framework to discuss the function of TFIIE in the context of RNA polymerase II transcription initiation.
15385556 structural integrity of the zinc finger domain is essential for the TFIIE function
9121429 HIV-1 Tat interacts with the RNA polymerase II holoenzyme and transcription preinitiation complexes, which include TFIIE, during Tat-mediated transactivation of the HIV-1 LTR
9054383 HIV-1 Tat interacts with the RNA polymerase II holoenzyme and transcription preinitiation complexes, which include TFIIE, during Tat-mediated transactivation of the HIV-1 LTR
8934526 HIV-1 Tat interacts with the RNA polymerase II holoenzyme and transcription preinitiation complexes, which include TFIIE, during Tat-mediated transactivation of the HIV-1 LTR
8849451 HIV-1 Tat interacts with the RNA polymerase II holoenzyme and transcription preinitiation complexes, which include TFIIE, during Tat-mediated transactivation of the HIV-1 LTR

AA Sequence

MADPDVLTEVPAALKRLAKYVIRGFYGIEHALALDILIRNSCVKEEDMLELLKFDRKQLRSVLNNLKGDK      1 - 70
FIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLE     71 - 140
ANQLFDPMTGTFRCTFCHTEVEEDESAMPKKDARTLLARFNEQIEPIYALLRETEDVNLAYEILEPEPTE    141 - 210
IPALKQSKDHAATTAGAASLAGGHHREAWATKGPSYEDLYTQNVVINMDDQEDLHRASLEGKSAKERPIW    211 - 280
LRESTVQGAYGSEDMKEGGIDMDAFQEREEGHAGPDDNEEVMRALLIHEKKTSSAMAGSVGAAAPVTAAN    281 - 350
GSDSESETSESDDDSPPRPAAVAVHKREEDEEEDDEFEEVADDPIVMVAGRPFSYSEVSQRPELVAQMTP    351 - 420
EEKEAYIAMGQRMFEDLFE                                                       421 - 439
//

Text Mined References (48)

PMID Year Title
27193682 2016 Near-atomic resolution visualization of human transcription promoter opening.
25492609 2015 Association of the winged helix motif of the TFIIE? subunit of TFIIE with either the TFIIE? subunit or TFIIB distinguishes its functions in transcription.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19106100 2009 MCAF1/AM is involved in Sp1-mediated maintenance of cancer-associated telomerase activity.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18354501 2008 Structural insight into the TFIIE-TFIIH interaction: TFIIE and p53 share the binding region on TFIIH.
18160537 2008 p53 and TFIIEalpha share a common binding site on the Tfb1/p62 subunit of TFIIH.
16547462 2006 Structure and oligomeric state of human transcription factor TFIIE.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15843171 2005 Varicella-zoster virus IE63 protein represses the basal transcription machinery by disorganizing the pre-initiation complex.
15385556 2004 A novel zinc finger structure in the large subunit of human general transcription factor TFIIE.
12665589 2003 The carboxy terminus of the small subunit of TFIIE regulates the transition from transcription initiation to elongation by RNA polymerase II.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11509574 2001 Structural and functional interactions of transcription factor (TF) IIA with TFIIE and TFIIF in transcription initiation by RNA polymerase II.
11416139 2001 Inhibition of androgen receptor-mediated transcription by amino-terminal enhancer of split.
11113176 2001 Studies of nematode TFIIE function reveal a link between Ser-5 phosphorylation of RNA polymerase II and the transition from transcription initiation to elongation.
10827951 2000 Mechanism of ATP-dependent promoter melting by transcription factor IIH.
9765293 1998 FCP1, the RAP74-interacting subunit of a human protein phosphatase that dephosphorylates the carboxyl-terminal domain of RNA polymerase IIO.
9677423 1998 Analysis of the role of TFIIE in transcriptional regulation through structure-function studies of the TFIIEbeta subunit.
9632676 1998 The putative cofactor TIF1alpha is a protein kinase that is hyperphosphorylated upon interaction with liganded nuclear receptors.
9418848 1998 Involvement of negative cofactor NC2 in active repression by zinc finger-homeodomain transcription factor AREB6.
9405375 1997 Three transitions in the RNA polymerase II transcription complex during initiation.
9305922 1997 Interaction of elongation factors TFIIS and elongin A with a human RNA polymerase II holoenzyme capable of promoter-specific initiation and responsive to transcriptional activators.
9121429 1997 The human immunodeficiency virus transactivator Tat interacts with the RNA polymerase II holoenzyme.
9054383 1997 Association of Tat with purified HIV-1 and HIV-2 transcription preinitiation complexes.
8946909 1996 The general transcription factors of RNA polymerase II.
8934526 1996 Enhanced processivity of RNA polymerase II triggered by Tat-induced phosphorylation of its carboxy-terminal domain.
8849451 1996 Tat-SF1: cofactor for stimulation of transcriptional elongation by HIV-1 Tat.
8162052 1994 Genes encoding general initiation factors for RNA polymerase II transcription are dispersed in the human genome.
8152490 1994 Dual role of TFIIH in DNA excision repair and in transcription by RNA polymerase II.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7926747 1994 Transcription factor IIE binds preferentially to RNA polymerase IIa and recruits TFIIH: a model for promoter clearance.
7829083 1994 Localization of the human genes encoding the two subunits of general transcription factor TFIIE.
7667268 1995 Evolutionary conservation of human TATA-binding-polypeptide-associated factors TAFII31 and TAFII80 and interactions of TAFII80 with other TAFs and with general transcription factors.
7651391 1995 The Epstein-Barr virus nuclear protein 2 acidic domain forms a complex with a novel cellular coactivator that can interact with TFIIE.
3029109 1987 Factors involved in specific transcription by mammalian RNA polymerase II. Purification and functional analysis of initiation factors IIB and IIE.
2449431 1988 ATP activates transcription initiation from promoters by RNA polymerase II in a reversible step prior to RNA synthesis.
2251258 1990 Factors involved in specific transcription by mammalian RNA polymerase II: purification and characterization of general transcription factor TFIIE.
2026628 1991 Factors involved in specific transcription by mammalian RNA polymerase II. Purification and functional analysis of general transcription factor IIE.
1956403 1991 Structural motifs and potential sigma homologies in the large subunit of human general transcription factor TFIIE.
1956398 1991 Structure and functional properties of human general transcription factor IIE.
1939271 1991 Abortive initiation is increased only for the weakest members of a set of down mutants of the adenovirus 2 major late promoter.
1454543 1992 Identification of two large subdomains in TFIIE-alpha on the basis of homology between Xenopus and human sequences.