Property Summary

NCBI Gene PubMed Count 44
PubMed Score 0.68
PubTator Score 15.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 2.700 2.7e-02
hepatocellular carcinoma 1.200 5.6e-05
lung cancer 1.200 5.0e-03
malignant mesothelioma 1.300 4.1e-07
ovarian cancer 1.200 1.9e-03

PDB (13)

Gene RIF (14)

AA Sequence

MADPDVLTEVPAALKRLAKYVIRGFYGIEHALALDILIRNSCVKEEDMLELLKFDRKQLRSVLNNLKGDK      1 - 70
FIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLE     71 - 140
ANQLFDPMTGTFRCTFCHTEVEEDESAMPKKDARTLLARFNEQIEPIYALLRETEDVNLAYEILEPEPTE    141 - 210
IPALKQSKDHAATTAGAASLAGGHHREAWATKGPSYEDLYTQNVVINMDDQEDLHRASLEGKSAKERPIW    211 - 280
LRESTVQGAYGSEDMKEGGIDMDAFQEREEGHAGPDDNEEVMRALLIHEKKTSSAMAGSVGAAAPVTAAN    281 - 350
GSDSESETSESDDDSPPRPAAVAVHKREEDEEEDDEFEEVADDPIVMVAGRPFSYSEVSQRPELVAQMTP    351 - 420
EEKEAYIAMGQRMFEDLFE                                                       421 - 439
//

Text Mined References (51)

PMID Year Title