Property Summary

NCBI Gene PubMed Count 30
PubMed Score 16.54
PubTator Score 9.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 5.0e-06
Multiple myeloma 1332 5.4e-04
oligodendroglioma 2850 1.6e-02

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.391 5.4e-04
oligodendroglioma -1.100 1.6e-02
ovarian cancer -1.100 5.0e-06

Protein-protein Interaction (5)

PDB (10)

Gene RIF (7)

AA Sequence

MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDN      1 - 70
VWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE                                    71 - 109
//

Text Mined References (33)

PMID Year Title